vanU gene in vanG cluster

Accession ARO:3004253
Synonym(s)vanUG
CARD Short NamevanU_in_vanG_cl
DefinitionAlso known as vanUG, is a vanG variant found in the vanG gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanU
Drug Classglycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Resistomes with Perfect MatchesClostridioides difficilewgs, Streptococcus agalactiaeg, Streptococcus anginosusg
Resistomes with Sequence VariantsClostridioides difficilewgs, Streptococcus agalactiaeg, Streptococcus anginosusg
Classification11 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ part_of glycopeptide resistance gene cluster VanG
+ vanU [AMR Gene Family]
Publications

Boyd DA, et al. 2006. Antimicrob Agents Chemother 50(6): 2217-2221. VanG-type vancomycin-resistant Enterococcus faecalis strains isolated in Canada. (PMID 16723588)

Depardieu F, et al. 2003. Mol Microbiol 50(3): 931-948. The vanG glycopeptide resistance operon from Enterococcus faecalis revisited. (PMID 14617152)

McKessar SJ, et al. 2000. Antimicrob Agents Chemother 44(11): 3224-3228. Genetic characterization of vanG, a novel vancomycin resistance locus of Enterococcus faecalis. (PMID 11036060)

Resistomes

Prevalence of vanU gene in vanG cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Clostridioides difficile0%0%0.19%0%
Streptococcus agalactiae1.18%0%0%0%
Streptococcus anginosus9.09%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 125


>gb|ABA71726.1|+|vanU gene in vanG cluster [Enterococcus faecalis]
MRVSYNKLWKLLIDRDMKKGELREAVGVSKSTFAKLGKNENVSLTVLLAICEYLNCDFGDIIEALPETPDKERDS


>gb|DQ212986.1|+|2030-2257|vanU gene in vanG cluster [Enterococcus faecalis]
ATGCGTGTTAGTTATAATAAGCTCTGGAAGCTTTTAATTGATAGGGACATGAAAAAAGGCGAGCTTCGTGAGGCTGTTGGAGTAAGTAAA
AGCACATTTGCGAAATTGGGCAAGAATGAGAATGTTTCTTTGACTGTTTTGTTAGCAATATGTGAGTATTTGAATTGTGATTTTGGCGAT
ATTATAGAAGCGTTGCCAGAAACCCCCGATAAGGAGCGTGACAGTTGA