mphK

Accession ARO:3004541
CARD Short NamemphK
DefinitionA chromosomal macrolide phosphotransferase identified from Bacillus subtilis.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesBacillus subtilisg+wgs
Resistomes with Sequence VariantsBacillus halotoleransg+wgs, Bacillus subtilisg+wgs, Bacillus tequilensisg+wgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic telithromycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
Publications

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphK among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Bacillus halotolerans83.33%0%82.76%0%
Bacillus subtilis97.29%0%76.7%0%
Bacillus tequilensis100%0%33.33%0%
Escherichia coli0%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AJE92936.1|+|mphK [Bacillus subtilis subsp. subtilis]
MTNLNEKQLITEIVGLARSQGLTVHSENAQLNETGMDFQVVFAKDDTGMPWVLRKPRRSDVVERASAEGITLAFLRANLTADVPDWRIHT
PELIAYPMLKGTPAAGIDLEQKQYVWNMDHQPPSDDFVRTLADILAELHGTDQISAGQSGIEVIRPEDFRQMTADSMVDVKNKLGVSTTL
WERWQKWVDDDAYWPGFSSLIHGDLHPPHILIDQNGRVTGLLDWTEAKVADPAKDFVLYQTIFGEKETARLLEYYDQAGGRIWAKMQEHI
SEMQAAYPVEIAKLALQTQQEEHINMALEALGVTSD


>gb|CP010314.1|+|275838-276758|mphK [Bacillus subtilis subsp. subtilis]
ATGACAAACCTTAACGAAAAACAGCTTATCACTGAGATTGTCGGGCTTGCACGCAGCCAAGGTTTGACGGTTCATTCTGAGAACGCGCAA
TTGAATGAAACCGGAATGGACTTTCAAGTTGTATTTGCCAAGGACGACACAGGTATGCCATGGGTGCTGCGAAAACCGCGGCGAAGTGAT
GTTGTGGAAAGAGCATCTGCAGAAGGCATAACGCTTGCCTTTCTCCGCGCGAATCTGACTGCTGATGTGCCGGATTGGAGAATTCATACA
CCGGAATTGATCGCTTACCCCATGTTAAAAGGAACGCCGGCTGCTGGAATTGACTTGGAACAAAAGCAATATGTATGGAATATGGATCAT
CAGCCGCCGTCAGACGACTTTGTCCGCACACTTGCCGACATACTGGCTGAATTACATGGCACGGATCAAATATCTGCTGGGCAATCCGGA
ATAGAAGTGATAAGGCCAGAAGATTTCAGGCAAATGACAGCAGACTCTATGGTTGATGTGAAGAATAAGCTTGGCGTATCTACGACGCTT
TGGGAAAGATGGCAAAAGTGGGTAGATGATGATGCATACTGGCCGGGTTTCTCTTCTTTGATACACGGCGATCTCCACCCGCCGCATATC
CTTATCGATCAAAATGGACGTGTCACAGGACTTCTGGATTGGACAGAAGCGAAGGTTGCTGACCCAGCCAAGGATTTTGTTCTTTATCAA
ACCATTTTCGGAGAAAAAGAAACTGCCCGTTTGCTTGAATACTATGATCAAGCAGGCGGCCGAATATGGGCAAAAATGCAGGAACACATC
TCAGAGATGCAGGCGGCGTATCCGGTGGAAATCGCCAAGCTAGCTCTGCAAACACAGCAGGAGGAACACATCAATATGGCGCTGGAAGCA
CTTGGTGTAACATCGGATTAA