dfrA6

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004547
Synonym(s)dfr6
CARD Short NamedfrA6
DefinitionA dihydrofolate reductase and antibiotic resistance gene identified from an integron in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesVibrio fluvialiswgs
Resistomes with Sequence VariantsEctopseudomonas mendocinawgs, Escherichia colip, Providencia rettgerig+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Vibrio alginolyticuswgs, Vibrio choleraewgs, Vibrio fluvialiswgs, Vibrio harveyip, Vibrio parahaemolyticusg+p+wgs, Vibrio vulnificuswgs
Publications

Kumar P, et al. 2009. Antimicrob. Agents Chemother. 53(11):4959-60 Presence of dfr6 gene cassette in superintegron of non-O1/non-O139 strain of Vibrio cholerae. (PMID 19704128)

Resistomes

Prevalence of dfrA6 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Ectopseudomonas mendocina0%0%7.14%0%0%
Escherichia coli0%0.01%0%0%0%
Providencia rettgeri2.94%0%1.27%0%0%
Providencia stuartii0%0%2.27%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Vibrio alginolyticus0%0%0.4%0%0%
Vibrio cholerae0%0%0.19%0%0%
Vibrio fluvialis0%0%18.67%0%0%
Vibrio harveyi0%14.29%0%0%0%
Vibrio parahaemolyticus0.32%0.31%0.57%0%0%
Vibrio vulnificus0%0%0.82%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ACY06082.1|+|dfrA6 [Vibrio cholerae]
MKISIMAAVSENGVIGSGLDIPWHVYGEQLLFKAMTYNHWLLVGRKTFDSMGKLPNRKYAVVTRTEMVSNDPDVVYFTSVESALAYLDHT
TTHVFVSGGGEIYKALIEQADVIHLSVIHKHISGDVFFPSVPQSFKQTFEQSFSSNIDYTYQIWTKG


>gb|FJ905898.1|+|329-802|dfrA6 [Vibrio cholerae]
ATGAAAATATCCATTATGGCAGCTGTTTCCGAGAATGGAGTAATTGGCTCTGGATTGGATATACCTTGGCATGTATATGGTGAGCAGCTC
CTGTTCAAAGCTATGACTTACAATCATTGGCTTTTAGTCGGTCGTAAAACTTTCGACTCAATGGGTAAACTTCCGAATAGGAAATATGCT
GTGGTTACTCGTACTGAAATGGTCTCGAATGATCCTGATGTTGTTTATTTCACAAGCGTTGAATCGGCATTAGCTTACTTAGACCACACG
ACAACACATGTCTTTGTTTCTGGTGGTGGTGAAATTTACAAAGCATTAATCGAACAAGCAGATGTTATCCATCTTTCAGTGATTCATAAG
CACATCTCTGGCGACGTGTTTTTCCCTTCAGTTCCACAGAGTTTCAAGCAAACATTTGAGCAAAGTTTCAGTTCAAATATTGATTACACG
TACCAAATTTGGACAAAGGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit