dfrA27

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004550
CARD Short NamedfrA27
DefinitionA dihydrofolate reductase and trimethoprim resistance gene from non-O1, non-O139 Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Enterobacter asburiaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatap+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Pseudomonas aeruginosap+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella flexnerip+wgs, Vibrio alginolyticusg, Vibrio choleraep, Vibrio harveyiwgs, Vibrio parahaemolyticusp+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter nosocomialiswgs, Aeromonas veroniig, Citrobacter freundiip+wgs, Citrobacter koseriwgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniip+wgs, Citrobacter youngaewgs, Comamonas testosteroniwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colig+p+wgs, Escherichia fergusoniiwgs, Klebsiella aerogenesp+wgs, Klebsiella huaxiensisg, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatap+wgs, Morganella morganiig+wgs, Proteus mirabilisg+wgs, Providencia alcalifaciensg, Providencia rettgerig+wgs, Pseudomonas aeruginosap+wgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shigella flexnerip+wgs, Vibrio alginolyticusg+wgs, Vibrio choleraep, Vibrio harveyiwgs, Vibrio parahaemolyticusp+wgs
Publications

Wu J, et al. 2015. Antimicrob. Agents Chemother. 59(7):4293-5 Molecular characterization of ISCR1-mediated blaPER-1 in a non-O1, non-O139 Vibrio cholerae strain from China. (PMID 25870070)

Resistomes

Prevalence of dfrA27 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.06%0%0%
Acinetobacter nosocomialis0%0%0.57%0%0%
Aeromonas veronii1.82%0%0%0%0%
Citrobacter freundii0%0.92%5.61%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%1.8%0%0%
Citrobacter werkmanii0%10%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Comamonas testosteroni0%0%7.14%0%0%
Enterobacter asburiae0%0%1.58%0%0%
Enterobacter cloacae0%0%0.32%0%0%
Enterobacter hormaechei0%0.51%3.11%0%0%
Enterobacter kobei0%0%3.06%0%0%
Enterobacter roggenkampii0%0.48%2.16%0%0%
Escherichia coli0.05%0.21%0.65%0%0%
Escherichia fergusonii0%0%1.09%0%0%
Klebsiella aerogenes0%1.09%1.13%0%0%
Klebsiella huaxiensis100%0%0%0%0%
Klebsiella michiganensis0%2.29%2.66%0%0%
Klebsiella oxytoca0%0%0.84%0%0%
Klebsiella pneumoniae0%1.54%4.96%0%0%
Klebsiella quasipneumoniae0%2.12%5.79%0%0%
Laribacter hongkongensis0%0%4.17%0%0%
Leclercia adecarboxylata0%4.76%4.65%0%0%
Morganella morganii3.85%0%1.84%0%0%
Proteus mirabilis2.75%0%0.66%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri5.88%0%0.64%0%0%
Pseudomonas aeruginosa0%1.46%0.16%0%0%
Raoultella planticola0%6.98%2.56%0%0%
Salmonella enterica0.19%0.33%0.35%0%0%
Serratia marcescens0%0%0.79%0%0%
Shigella flexneri0%1.2%0.31%0%0%
Vibrio alginolyticus1.23%0%0.79%0%0%
Vibrio cholerae0%5.26%0%0%0%
Vibrio harveyi0%0%4%0%0%
Vibrio parahaemolyticus0%0.62%0.05%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ACD45689.1|+|dfrA27 [Vibrio cholerae non-O1/non-O139]
MKISLMAAKARNGVIGCGSDIPWNAKGEQLLFKAITYNQWLLVGRKTFEAMGALPNRKYAVVSRSGSVATNDDVVVFPSIEAAMRELKTL
TNHVVVSGGGEIYKSLIAHADTLHISTIDSEPEGNVFFPEIPKEFNVVFEQEFHSNINYRYQIWQRG


>gb|KP076293.1|+|2348-2821|dfrA27 [Vibrio cholerae non-O1/non-O139]
GTGAAAATATCACTAATGGCTGCAAAAGCAAGAAATGGGGTTATTGGCTGCGGCTCGGATATCCCGTGGAACGCTAAAGGTGAGCAGCTG
CTTTTTAAAGCAATAACTTACAATCAATGGCTCTTAGTCGGCCGTAAAACATTTGAGGCAATGGGGGCTCTCCCAAATAGAAAGTATGCA
GTTGTCAGCCGCTCAGGATCGGTAGCTACTAACGATGATGTGGTTGTGTTTCCATCTATAGAAGCAGCAATGAGGGAGCTAAAGACTCTT
ACGAACCATGTTGTTGTTTCTGGTGGTGGAGAGATCTACAAGAGTCTGATCGCCCATGCCGACACGCTACATATCTCGACAATAGATTCC
GAGCCAGAGGGCAATGTTTTCTTTCCGGAAATCCCCAAAGAGTTCAATGTGGTGTTCGAGCAGGAATTTCATTCAAATATAAATTATCGC
TATCAAATCTGGCAAAGGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit