dfrA27

Download Sequences

Accession	ARO:3004550
CARD Short Name	dfrA27
Definition	A dihydrofolate reductase and trimethoprim resistance gene from non-O1, non-O139 Vibrio cholerae.
AMR Gene Family	trimethoprim resistant dihydrofolate reductase dfr
Drug Class	diaminopyrimidine antibiotic
Resistance Mechanism	antibiotic target replacement
Resistomes with Perfect Matches	Acinetobacter baumannii^g+wgs, Citrobacter freundii^p+wgs, Citrobacter portucalensis^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Comamonas testosteroni^wgs, Enterobacter asburiae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Laribacter hongkongensis^wgs, Leclercia adecarboxylata^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs, Providencia alcalifaciens^g, Providencia rettgeri^g+wgs, Pseudomonas aeruginosa^p+wgs, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella flexneri^p+wgs, Vibrio alginolyticus^g, Vibrio cholerae^p, Vibrio harveyi^wgs, Vibrio parahaemolyticus^p+wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^g+wgs, Acinetobacter nosocomialis^wgs, Aeromonas veronii^g, Citrobacter freundii^p+wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p+wgs, Citrobacter werkmanii^p+wgs, Citrobacter youngae^wgs, Comamonas testosteroni^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Enterobacter kobei^wgs, Enterobacter roggenkampii^p+wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella aerogenes^p+wgs, Klebsiella huaxiensis^g, Klebsiella michiganensis^p+wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Laribacter hongkongensis^wgs, Leclercia adecarboxylata^p+wgs, Morganella morganii^g+wgs, Proteus mirabilis^g+wgs, Providencia alcalifaciens^g, Providencia rettgeri^g+wgs, Pseudomonas aeruginosa^p+wgs, Raoultella planticola^p+wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^wgs, Shigella flexneri^p+wgs, Vibrio alginolyticus^g+wgs, Vibrio cholerae^p, Vibrio harveyi^wgs, Vibrio parahaemolyticus^p+wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic target replacement [Resistance Mechanism] + antibiotic target replacement protein + diaminopyrimidine antibiotic [Drug Class] + antibiotic resistant dihydrofolate reductase + trimethoprim [Antibiotic]
Parent Term(s)	2 ontology terms \| Show + confers_resistance_to_antibiotic trimethoprim [Antibiotic] + trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications	Wu J, et al. 2015. Antimicrob. Agents Chemother. 59(7):4293-5 Molecular characterization of ISCR1-mediated blaPER-1 in a non-O1, non-O139 Vibrio cholerae strain from China. (PMID 25870070)

Resistomes

Prevalence of dfrA27 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0.18%	0%	0.03%	0%
Acinetobacter baumannii	0.18%	0%	0.06%	0%
Acinetobacter nosocomialis	0%	0%	0.57%	0%
Acinetobacter nosocomialis	0%	0%	0%	0%
Aeromonas veronii	1.82%	0%	0%	0%
Aeromonas veronii	0%	0%	0%	0%
Citrobacter freundii	0%	0.62%	4.06%	0%
Citrobacter freundii	0%	0.92%	5.03%	0%
Citrobacter koseri	0%	0%	0%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	1.47%	0.9%	0%
Citrobacter werkmanii	0%	10%	2.56%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Citrobacter youngae	0%	0%	6.25%	0%
Comamonas testosteroni	0%	0%	7.14%	0%
Comamonas testosteroni	0%	0%	7.14%	0%
Enterobacter asburiae	0%	0%	0.79%	0%
Enterobacter asburiae	0%	0%	1.19%	0%
Enterobacter cloacae	0%	0%	0.32%	0%
Enterobacter cloacae	0%	0%	0%	0%
Enterobacter hormaechei	0%	0.13%	1.55%	0%
Enterobacter hormaechei	0%	0.51%	2.03%	0%
Enterobacter kobei	0%	0%	2.18%	0%
Enterobacter kobei	0%	0%	1.75%	0%
Enterobacter roggenkampii	0%	0%	1.8%	0%
Enterobacter roggenkampii	0%	0.48%	1.8%	0%
Escherichia coli	0.02%	0.18%	0.39%	0%
Escherichia coli	0.05%	0.21%	0.44%	0%
Escherichia fergusonii	0%	0%	1.09%	0%
Escherichia fergusonii	0%	0%	1.09%	0%
Klebsiella aerogenes	0%	0%	0.56%	0%
Klebsiella aerogenes	0%	1.09%	1.13%	0%
Klebsiella huaxiensis	100%	0%	0%	0%
Klebsiella huaxiensis	0%	0%	0%	0%
Klebsiella michiganensis	0%	2.29%	2.39%	0%
Klebsiella michiganensis	0%	1.14%	2.13%	0%
Klebsiella oxytoca	0%	0%	0.84%	0%
Klebsiella oxytoca	0%	0%	0.84%	0%
Klebsiella pneumoniae	0%	1.54%	3.27%	0%
Klebsiella pneumoniae	0%	0.97%	2.72%	0%
Klebsiella quasipneumoniae	0%	1.48%	4.61%	0%
Klebsiella quasipneumoniae	0%	2.12%	5.39%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Laribacter hongkongensis	0%	0%	2.08%	0%
Leclercia adecarboxylata	0%	4.76%	4.65%	0%
Leclercia adecarboxylata	0%	4.76%	4.65%	0%
Morganella morganii	3.85%	0%	1.23%	0%
Morganella morganii	3.85%	0%	1.23%	0%
Proteus mirabilis	2.75%	0%	0.5%	0%
Proteus mirabilis	2.75%	0%	0.17%	0%
Providencia alcalifaciens	9.09%	0%	0%	0%
Providencia alcalifaciens	9.09%	0%	0%	0%
Providencia rettgeri	5.88%	0%	0.64%	0%
Providencia rettgeri	5.88%	0%	0.64%	0%
Pseudomonas aeruginosa	0%	1.46%	0.07%	0%
Pseudomonas aeruginosa	0%	1.46%	0.16%	0%
Raoultella planticola	0%	2.33%	2.56%	0%
Raoultella planticola	0%	6.98%	2.56%	0%
Salmonella enterica	0.19%	0.33%	0.13%	0%
Salmonella enterica	0.19%	0.11%	0.08%	0%
Serratia marcescens	0%	0%	0.52%	0%
Serratia marcescens	0%	0%	0.52%	0%
Shigella flexneri	0%	0.8%	0.31%	0%
Shigella flexneri	0%	1.2%	0.31%	0%
Vibrio alginolyticus	1.23%	0%	0%	0%
Vibrio alginolyticus	1.23%	0%	0.4%	0%
Vibrio cholerae	0%	5.26%	0%	0%
Vibrio cholerae	0%	5.26%	0%	0%
Vibrio harveyi	0%	0%	2%	0%
Vibrio harveyi	0%	0%	4%	0%
Vibrio parahaemolyticus	0%	0.62%	0.05%	0%
Vibrio parahaemolyticus	0%	0.62%	0.05%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|ACD45689.1|+|dfrA27 [Vibrio cholerae non-O1/non-O139]
MKISLMAAKARNGVIGCGSDIPWNAKGEQLLFKAITYNQWLLVGRKTFEAMGALPNRKYAVVSRSGSVATNDDVVVFPSIEAAMRELKTL
TNHVVVSGGGEIYKSLIAHADTLHISTIDSEPEGNVFFPEIPKEFNVVFEQEFHSNINYRYQIWQRG

>gb|KP076293.1|+|2348-2821|dfrA27 [Vibrio cholerae non-O1/non-O139]
GTGAAAATATCACTAATGGCTGCAAAAGCAAGAAATGGGGTTATTGGCTGCGGCTCGGATATCCCGTGGAACGCTAAAGGTGAGCAGCTG
CTTTTTAAAGCAATAACTTACAATCAATGGCTCTTAGTCGGCCGTAAAACATTTGAGGCAATGGGGGCTCTCCCAAATAGAAAGTATGCA
GTTGTCAGCCGCTCAGGATCGGTAGCTACTAACGATGATGTGGTTGTGTTTCCATCTATAGAAGCAGCAATGAGGGAGCTAAAGACTCTT
ACGAACCATGTTGTTGTTTCTGGTGGTGGAGAGATCTACAAGAGTCTGATCGCCCATGCCGACACGCTACATATCTCGACAATAGATTCC
GAGCCAGAGGGCAATGTTTTCTTTCCGGAAATCCCCAAAGAGTTCAATGTGGTGTTCGAGCAGGAATTTCATTCAAATATAAATTATCGC
TATCAAATCTGGCAAAGGGGTTAA

dfrA27

Prevalence: protein homolog model (view sequences)

Graph