dfrA32

Accession ARO:3004555
CARD Short NamedfrA32
DefinitionA dihydrofolate reductase and trimethoprim resistance gene identified from non-typhoidal multidrug-resistant Salmonella enterica.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesActinobacillus pleuropneumoniaeg, Enterobacter hormaecheiwgs, Escherichia colig+wgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Pasteurella multocidag, Proteus mirabilisg+wgs, Salmonella entericawgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsActinobacillus pleuropneumoniaeg, Enterobacter hormaecheiwgs, Escherichia colig+wgs, Klebsiella pneumoniaeg+wgs, Klebsiella quasipneumoniaewgs, Laribacter hongkongensiswgs, Pasteurella multocidag+p, Proteus mirabilisg+wgs, Salmonella entericawgs, Vibrio parahaemolyticuswgs
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Krauland M, et al. 2010. Curr. Microbiol. 60(3):217-23 Novel integron gene cassette arrays identified in a global collection of multi-drug resistant non-typhoidal Salmonella enterica. (PMID 19921331)

Resistomes

Prevalence of dfrA32 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Actinobacillus pleuropneumoniae2.78%0%0%0%
Enterobacter hormaechei0%0%0.04%0%
Escherichia coli0.05%0%0.01%0%
Klebsiella pneumoniae0.06%0%0.02%0%
Klebsiella quasipneumoniae0%0%0.13%0%
Laribacter hongkongensis0%0%2.08%0%
Pasteurella multocida0.71%2.17%0%0%
Proteus mirabilis18.35%0%3.8%0%
Salmonella enterica0%0%0.02%0%
Vibrio parahaemolyticus0%0%0.05%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ACZ52983.1|+|dfrA32 [Salmonella enterica]
MKISLISAVSENGVIGSGPDIPWSAKGEQLIFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSKNGISGSNENVLVFPSIENALQELSKI
TDHVYISGGGQIYESLIEKADIIHLSTIHVEVEGDIKFPILPEGFNLVFEQFFVSNINYTYQIWKKG


>gb|GU067642.1|+|535-1008|dfrA32 [Salmonella enterica]
TTGAAAATTTCATTGATTTCTGCAGTGTCAGAAAATGGCGTAATCGGTAGTGGTCCTGATATTCCGTGGTCAGCAAAAGGTGAGCAGCTA
ATCTTTAAGGCGCTCACATACAATCAGTGGCTTCTTGTTGGAAGGAAAACATTTGACTCTATGGGAGTTCTTCCAAATCGCAAATATGCA
GTAGTGTCAAAGAATGGAATTTCAGGGTCAAATGAAAACGTCTTGGTTTTTCCTTCAATAGAAAATGCTTTGCAAGAACTATCTAAAATT
ACAGATCATGTATATATTTCGGGTGGGGGGCAAATCTATGAAAGCCTTATTGAAAAAGCAGATATAATTCATCTATCTACTATTCATGTT
GAGGTTGAAGGTGATATTAAATTCCCTATATTACCTGAAGGTTTCAACTTGGTTTTTGAACAGTTTTTTGTGTCTAATATAAATTATACA
TATCAAATTTGGAAAAAAGGCTAA