dfrA15b

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004640
CARD Short NamedfrA15b
DefinitionA dihydrofolate reductase found in Salmonella Enterica.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Sequence VariantsAeromonas caviaewgs, Enterobacter hormaecheiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Pseudomonas aeruginosawgs, Pseudomonas stutzeriwgs, Salmonella entericawgs, Shigella sonneiwgs
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Michael GB, et al. 2005. J Antimicrob Chemother 55(5): 776-779. Class 1 integron-associated gene cassettes in Salmonella enterica subsp. enterica serovar Agona isolated from pig carcasses in Brazil. (PMID 15761062)

Resistomes

Prevalence of dfrA15b among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae0%0%6.45%0%0%
Enterobacter hormaechei0%0%0.04%0%0%
Escherichia coli0%0.01%0.01%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.06%0.25%0%0%
Klebsiella quasipneumoniae0%0%0.13%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Pseudomonas stutzeri0%0%2.29%0%0%
Salmonella enterica0%0%0.04%0%0%
Shigella sonnei0%0%0.07%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|CAI29521.1|+|dfrA15b [Salmonella enterica subsp. enterica]
MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTI
TDHVIVSGGGEIYKSLIDKADTLHISTIDIEPEGDVYFPEIPGSFRPVFSKDFVSNINYSYQIWQKG


>gb|AJ867237.1|+|177-650|dfrA15b [Salmonella enterica subsp. enterica]
GTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTA
CTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCC
GTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATA
ACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGCTGATACTTTACATATTTCAACAATCGACATT
GAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCGGTAGTTTTAGGCCAGTTTTTAGCAAAGACTTCGTGTCCAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit