dfrA6 from Proteus mirabilis

Accession ARO:3004644
DefinitiondfrA6 is a dihydrofolate reductase that confers resistance to trimethoprim.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class trimethoprim [Antibiotic]
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Wylie BA, et al. 1991. J. Med. Microbiol. 35(4):214-8 Nucleotide sequence of dihydrofolate reductase type VI. (PMID 1941991)

Resistomes

Prevalence of dfrA6 from Proteus mirabilis among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Vibrio cholerae0%0%0.11%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|CAB06660.1|+|dfrA6 from Proteus mirabilis [Proteus mirabilis]
MKISLMAAVSENGVIGSGLDIPWHVQGEQLLFKAMTYNQWLLVGRKTFDSMGKLPNRKYAVVTRSKIISNDPDVVYFASVESALAYLNNA
TAHIFVSGGGEIYKALIDQADVIHLSVIHKHISGDVFFPPVPQGFKQTFEQSFSSNIDYTYQIWAKG


>gb|Z86002.1|+|336-809|dfrA6 from Proteus mirabilis [Proteus mirabilis]
ATGAAAATATCTCTTATGGCAGCTGTTTCCGAGAATGGAGTAATTGGCTCTGGATTGGATATACCTTGGCATGTACAAGGCGAGCAGCTC
CTATTCAAAGCCATGACTTACAATCAATGGCTTCTAGTTGGTCGTAAAACCTTCGACTCAATGGGTAAACTTCCGAATAGAAAATATGCA
GTGGTTACTCGTTCTAAAATTATCTCGAATGACCCTGATGTTGTGTATTTCGCAAGTGTTGAATCGGCATTAGCTTACCTAAACAATGCG
ACAGCACATATCTTTGTTTCTGGTGGTGGTGAAATATATAAAGCTTTAATCGATCAAGCAGATGTTATCCATCTTTCAGTGATTCACAAG
CATATCTCTGGCGATGTGTTTTTTCCTCCAGTTCCACAGGGCTTCAAGCAAACATTTGAGCAAAGTTTCAGTTCAAATATTGATTACACG
TACCAAATTTGGGCAAAGGGCTAA