Neisseria gonorrhoeae mtrR with mutation conferring resistance

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3004851
CARD Short NameNgon_mtrR_AZM
DefinitionMtrR is a repressor of mtrCDE efflux pump expression, point mutations in mtrR confer resistance to azithromycin and other drugs.
AMR Gene Familyresistance-nodulation-cell division (RND) antibiotic efflux pump, antibiotic efflux regulatory protein
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) or two-component regulatory system modulating antibiotic efflux
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ resistance-nodulation-cell division (RND) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ antibiotic efflux regulatory protein [AMR Gene Family]
Resistomes with Sequence VariantsNeisseria gonorrhoeaeg+p+wgs
Publications

Warner DM, et al. 2008. Mol Microbiol 70(2): 462-478. Clinically relevant mutations that cause derepression of the Neisseria gonorrhoeae MtrC-MtrD-MtrE Efflux pump system confer different levels of antimicrobial resistance and in vivo fitness. (PMID 18761689)

Zarantonelli L, et al. 1999. Antimicrob. Agents Chemother. 43(10):2468-72 Decreased azithromycin susceptibility of Neisseria gonorrhoeae due to mtrR mutations. (PMID 10508026)

Resistomes

Prevalence of Neisseria gonorrhoeae mtrR with mutation conferring resistance among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Neisseria gonorrhoeae21.25%0.51%20%0%0%
Show Perfect Only


Detection Models

Model Type: protein variant model

Model Definition: Protein Variant Models (PVM) perform a similar search as Protein Homolog Models (PHM), i.e. detect protein sequences based on their similarity to a curated reference sequence, but secondarily screen query sequences for curated sets of mutations to differentiate them from antibiotic susceptible wild-type alleles. PVMs are designed to detect AMR acquired via mutation of house-keeping genes or antibiotic targets, e.g. a mutated gyrase resistant to aminocoumarin antibiotics. PVMs include a protein reference sequence (often from antibiotic susceptible wild-type alleles), a curated bit-score cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of single point mutations, insertions, or deletions curated from the scientific literature. A Strict RGI match has a BLASTP bit-score above the curated BLASTP cutoff value and contains at least one curated mutation from amongst the mapped resistance variants, while a Loose RGI match has a bit-score less than the curated BLASTP bit-score cut-off but still contains at least one curated mutation from amongst the mapped resistance variants.

Bit-score Cut-off (blastP): 400

PubMed: mutation data hand curated from the scientific literature, evaluated as conferring resistance (R). CRyPTIC: mutation data acquired from the CRyPTIC catalog, evaluated as resistant (R), susceptible (S), or undetermined (U). ReSeqTB: mutation data acquired from the ReSeqTB catalog, evaluated as conferring resistance (Minimal, Moderate, High), not conferring resistance (None), or Indeterminate. WHO: mutation data acquired from the WHO 2023 catalog, evaluated as resistant (R), susceptible (S), or undetermined (U).

MutationMutation typePubMed
A39Tsingle resistance variantPMID:18761689
G45Dsingle resistance variantPMID:18761689

>gb|ACF30254.1|+|Neisseria gonorrhoeae mtrR with mutation conferring resistance [Neisseria gonorrhoeae NCCP11945]
MRKTKTEALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRGALYWHFKNKEDLFDA
LFQRICDDIENCIAQDAADAEGGSWTVFRHTLLHFFERLQSNDIYYKFHNILFLKCEHTE
QNAAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSS
GESFDLGKTAPRIIGIMMDNLENHPCLRRK



>gb|CP001050.1|+|1332867-1333499|Neisseria gonorrhoeae mtrR with mutation conferring resistance [Neisseria gonorrhoeae NCCP11945]
ATGAGAAAAACCAAAACCGAAGCCTTGAAAACCAAAGAACACCTGATGCTTGCCGCCTTGGAAACCTTTTACCGCAAAGGGATTGCCCGC
ACCTCGCTCAACGAAATCGCCCAAGCCGCCGGCGTAACGCGCGGCGCGCTCTATTGGCATTTCAAAAATAAGGAAGACTTGTTTGACGCG
TTGTTCCAACGTATCTGCGACGACATCGAAAACTGCATCGCGCAAGATGCCGCAGATGCCGAAGGAGGTTCTTGGACGGTATTCCGCCAC
ACGCTGCTGCACTTTTTCGAGCGGCTGCAAAGCAACGACATCTACTACAAATTCCACAACATCCTGTTTTTAAAATGCGAACACACGGAG
CAAAACGCCGCCGTTATCGCCATTGCCCGCAAGCATCAGGCAATCTGGCGCGAGAAAATTACCGCCGTTTTGACCGAAGCGGTGGAAAAT
CAGGATTTGGCTGACGATTTGGACAAGGAAACGGCGGTCATCTTCATCAAATCGACGTTGGACGGGCTGATTTGGCGTTGGTTCTCTTCC
GGCGAAAGTTTCGATTTGGGCAAAACCGCCCCGCGCATCATCGGGATAATGATGGACAACTTGGAAAACCATCCCTGCCTGCGCCGGAAA
TAA

Curator Acknowledgements
Curator Description Most Recent Edit