CrcB

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005049
CARD Short NameCrcB
DefinitionCrcB is part of the Camphor Resistance Protein Family. It confers resistance to aminoglycoside antibiotics.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification8 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_drug_class aminoglycoside antibiotic [Drug Class]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
+ confers_resistance_to_antibiotic gentamicin [Antibiotic]
Resistomes with Perfect MatchesKlebsiella pneumoniaeg+wgs
Resistomes with Sequence VariantsKlebsiella pneumoniaeg+wgs
Publications

Fookes M, et al. 2013. Genome Announc 1(1): Genome Sequence of Klebsiella pneumoniae Ecl8, a Reference Strain for Targeted Genetic Manipulation. (PMID 23405357)

Muraya A, et al. 2022. Pathogens 11(5): Antimicrobial Resistance and Virulence Characteristics of Klebsiella pneumoniae Isolates in Kenya by Whole-Genome Sequencing. (PMID 35631066)

Resistomes

Prevalence of CrcB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Klebsiella pneumoniae4.62%0%5.29%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 250


>gb|CCN31428.1|+|CrcB [Klebsiella pneumoniae subsp. pneumoniae Ecl8]
MLNFTILIFVGGAFGAICRELLMLVVPRLSDGFPLDIFIANIIAAFLLGLCTSLYKRNRVNQYIHMMVATGIMGGLSTFSSFVSGAVEMM
NEPLSALIAICYLVISLIVGFMAVELGLRLGSRVKPAPPMTHNRSTG


>gb|HF536482.1|+|4176810-4177223|CrcB [Klebsiella pneumoniae subsp. pneumoniae Ecl8]
GTGCTTAATTTTACTATTCTGATCTTTGTTGGCGGGGCGTTTGGCGCAATATGCCGCGAATTATTGATGTTGGTAGTGCCTCGCCTGAGC
GATGGCTTTCCCCTGGATATCTTCATCGCCAATATTATTGCCGCTTTTTTGCTTGGTTTATGCACATCACTGTATAAAAGGAACCGGGTT
AATCAGTACATCCATATGATGGTGGCTACGGGTATCATGGGAGGGCTATCAACCTTCTCCAGCTTTGTATCTGGCGCGGTGGAAATGATG
AATGAGCCACTCAGCGCGCTGATCGCCATCTGTTATCTGGTTATCAGCCTGATAGTCGGTTTTATGGCTGTGGAGCTGGGGTTAAGACTG
GGCTCCCGAGTAAAGCCTGCGCCGCCCATGACTCATAACAGATCGACTGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit