patA

Accession ARO:3000024
DefinitionPatA is an ABC transporter of Streptococcus pneumoniae that interacts with PatB to confer fluoroquinolone resistance.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classacridine dye, cephalosporin, tetracycline antibiotic, macrolide antibiotic, rifamycin antibiotic, pleuromutilin antibiotic, peptide antibiotic, fluoroquinolone antibiotic, penam, nitroimidazole antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
ResistomesStreptococcus pneumoniaeg+wgs
Classification21 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

El Garch F, et al. 2010. J Antimicrob Chemother 65(10): 2076-2082. Fluoroquinolones induce the expression of patA and patB, which encode ABC efflux pumps in Streptococcus pneumoniae. (PMID 20709735)

Garvey MI, et al. 2010. Antimicrob Agents Chemother 55(1): 190-196. Overexpression of patA and patB, which encode ABC transporters, is associated with fluoroquinolone resistance in clinical isolates of Streptococcus pneumoniae. (PMID 20937787)

Resistomes

Prevalence of patA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Mycobacterium tuberculosis0%0%0.03%
Streptococcus pneumoniae99.21%0%98.48%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 750


>gb|AAK76137.1|-|patA [Streptococcus pneumoniae TIGR4]
MLIQKIKTYKWQALASLLMTGLMVASSLLQPRYLQEVLGALLTGKYEAIYSIGAWLIGVAVVGLVAGGLNVVLAAYIAQGVSSDLREDAF
RKIQTFSYADIEQFNAGNLVVRMTNDINQIQNVVMMTFQILFRLPLLFIGSFILAVQTLPSLWWVIVLMVVLIFGLTAVMMGMMGPRFAK
FQTLLERINAIAKENLRGVRVVKSFVQEKEQFAKFTEVSDELLGQNLYIGYAFSVVEPFMMLVGYGAVFLSIWLVAGMVQSDPSVVGSIA
SFVNYLSQIIFTIVMVGFLGNSVSRAMISMRRIREILDAEPAMTFKDIPDEELVGSLSFENVTFTYPMDKEPMLKDVSFTIEPGQMVGVV
GATGAGKSTLAQLIPRLFDPQDGAIKIGGKDIREVSEGTLRKTVSIVLQRAILFSGTIADNLRQGKGNATLFEMERAANIAQASEFIHRM
EKTFESPVEERGTNFSGGQKQRMSIARGIVSNPRILIFDDSTSALDAKSERLVQEALNKDLKGTTTIIIAQKISSVVHADKILVLNQGRL
IGQGTHADLVANNAVYREIYETQK


>gb|AE005672.3|-|1983116-1984810|patA [Streptococcus pneumoniae TIGR4]
ATGCTGATTCAGAAAATAAAAACCTACAAGTGGCAGGCCCTGGCTTCGCTCCTGATGACAGGCTTGATGGTTGCTAGTTCACTTCTGCAA
CCGCGTTATCTGCAGGAAGTCTTAGGCGCCCTCCTTACTGGGAAATATGAAGCTATTTATAGTATCGGGGCTTGGTTGATTGGTGTGGCC
GTAGTCGGTCTAGTTGCTGGTGGACTCAATGTTGTCCTCGCAGCCTATATTGCCCAAGGAGTTTCATCCGACCTTCGGGAGGATGCCTTC
CGTAAAATTCAAACCTTTTCTTATGCTGATATTGAACAATTTAATGCGGGAAATCTAGTCGTTCGAATGACAAATGATATCAACCAGATT
CAGAACGTTGTCATGATGACCTTCCAAATTCTTTTCAGACTTCCCCTCTTGTTCATCGGTTCGTTTATCCTAGCGGTTCAAACCTTACCT
TCTCTGTGGTGGGTGATTGTTCTCATGGTAGTCTTGATTTTTGGTTTGACTGCTGTCATGATGGGAATGATGGGGCCTCGTTTTGCCAAG
TTTCAAACCCTTCTTGAGCGCATCAATGCCATTGCCAAGGAAAATTTACGTGGCGTTCGTGTGGTCAAGTCCTTTGTCCAAGAAAAAGAG
CAATTTGCTAAGTTTACAGAGGTCTCAGACGAGCTTCTTGGTCAAAACCTTTACATTGGTTATGCCTTTTCAGTAGTGGAACCCTTTATG
ATGTTGGTTGGTTACGGGGCGGTCTTCCTCTCTATTTGGCTGGTCGCGGGAATGGTTCAGTCGGATCCGTCTGTTGTTGGTTCCATCGCT
TCTTTTGTTAATTACCTAAGCCAGATTATCTTTACCATTGTTATGGTTGGATTTTTGGGAAATTCTGTCAGCCGTGCCATGATTTCCATG
CGTCGTATTCGAGAAATTCTTGACGCAGAGCCAGCTATGACCTTCAAGGATATCCCAGATGAAGAGTTGGTTGGAAGTCTTAGCTTTGAA
AATGTGACCTTTACCTATCCAATGGACAAGGAACCGATGCTGAAAGATGTGAGCTTTACTATTGAACCTGGTCAAATGGTTGGTGTAGTT
GGAGCGACTGGTGCAGGAAAGTCAACCTTGGCTCAATTGATTCCACGTCTCTTTGATCCACAGGACGGGGCCATTAAAATCGGTGGCAAG
GATATTCGAGAAGTGAGTGAAGGAACCCTGCGTAAAACAGTTTCCATCGTTCTCCAACGTGCCATTCTTTTTAGTGGAACGATTGCAGAT
AACTTGAGACAGGGGAAGGGGAATGCTACTCTATTTGAAATGGAGCGCGCAGCCAATATTGCCCAGGCTAGTGAATTCATTCATCGTATG
GAGAAAACCTTTGAAAGTCCAGTTGAAGAACGGGGAACCAATTTCTCTGGTGGACAAAAACAAAGGATGTCGATTGCGCGTGGGATTGTC
AGCAATCCACGTATTCTGATTTTTGATGATTCGACCTCAGCCTTGGATGCCAAATCAGAGCGCTTGGTGCAAGAAGCTTTGAATAAGGAC
TTGAAGGGGACGACAACCATTATTATTGCTCAAAAAATTAGCTCGGTTGTCCATGCAGACAAGATCTTGGTTCTAAATCAAGGACGATTG
ATTGGTCAAGGTACGCATGCAGACTTGGTTGCCAACAATGCCGTTTACCGTGAAATCTATGAAACACAGAAATGA