mepA

Accession ARO:3000026
CARD Short NamemepA
DefinitionMepA is an efflux protein regulated by MepR and part of the MepRAB cluster. Its presence in Staphylococcus aureus led to multidrug resistance, while it has also been shown to decrease tigecycline susceptibility.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesStaphylococcus aureusg+p+wgs
Resistomes with Sequence VariantsEnterobacter hormaecheiwgs, Escherichia coliwgs, Pseudomonas aeruginosawgs, Serratia marcescenswgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs, Staphylococcus hominiswgs, Stenotrophomonas maltophiliawgs, Streptococcus pneumoniaewgs, Vibrio choleraewgs
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ confers_resistance_to_drug_class glycylcycline [Drug Class]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
Sub-Term(s)
1 ontology terms | Show
+ mepR regulates
Publications

McAleese F, et al. 2005. Antimicrob Agents Chemother 49(5): 1865-1871. A novel MATE family efflux pump contributes to the reduced susceptibility of laboratory-derived Staphylococcus aureus mutants to tigecycline. (PMID 15855508)

Kaatz GW, et al. 2005. Antimicrob Agents Chemother 49(5): 1857-1864. Multidrug resistance in Staphylococcus aureus due to overexpression of a novel multidrug and toxin extrusion (MATE) transport protein. (PMID 15855507)

Kaatz GW, et al. 2006. Antimicrob Agents Chemother 50(4): 1276-1281. MepR, a repressor of the Staphylococcus aureus MATE family multidrug efflux pump MepA, is a substrate-responsive regulatory protein. (PMID 16569840)

Resistomes

Prevalence of mepA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter hormaechei0%0%0.09%0%
Escherichia coli0%0%0.02%0%
Pseudomonas aeruginosa0%0%0.02%0%
Serratia marcescens0%0%0.14%0%
Staphylococcus aureus99.9%0.12%58.8%0%
Staphylococcus epidermidis0%0%0.09%0%
Staphylococcus hominis0%0%1.03%0%
Stenotrophomonas maltophilia0%0%0.17%0%
Streptococcus pneumoniae0%0%0.01%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|AAU95768.1|+|mepA [Staphylococcus aureus]
MKDEQLYYFEKSPVFKAMMHFSLPMMIGTLLSVIYGILNIYFIGFLEDSHMISAISLTLPVFAILMGLGNLFGVGAGTYISRLLGAKDYS
KSKFVSSFSIYGGIALGLIVILVTLPFSDQIAAILGARGETLALTSNYLKVMFLSAPFVILFFILEQFARAIGAPMVSMIGMLASVGLNI
ILDPILIFGFDLNVVGAALGTAISNVAAALFFIIYFMKNSDVVSVNIKLAKPNKEMLSEIFKIGIPAFLMSILMGFTGLVLNLFLAHYGN
FAIASYGISFRLVQFPELIIMGLCEGVVPLIAYNFMANKGRMKDVIKAVIMSIGVIFVVCMSAVFTIGHHMVGLFTTDQAIVEMATFILK
VTMASLLLNGIGFLFTGMLQATGQGRGATIMAILQGAIIIPVLFIMNALFGLTGVIWSLLIAESLCALAAMLIVYLLRDRLTVDTSELIE
G


>gb|AY661734.1|+|840-2195|mepA [Staphylococcus aureus]
ATGAAAGACGAACAATTATATTATTTTGAGAAATCGCCAGTATTTAAAGCGATGATGCATTTCTCATTGCCAATGATGATAGGGACTTTA
TTAAGCGTTATTTATGGCATATTAAATATTTACTTTATAGGATTTTTAGAAGATAGCCACATGATTTCTGCTATCTCTCTAACACTGCCA
GTATTTGCTATCTTAATGGGGTTAGGTAATTTATTTGGCGTTGGTGCAGGAACTTATATTTCACGTTTATTAGGTGCGAAAGACTATAGT
AAGAGTAAATTTGTAAGTAGTTTCTCTATTTATGGTGGTATTGCACTAGGACTTATCGTGATTTTAGTTACTTTACCATTCAGTGATCAA
ATCGCAGCAATTTTAGGGGCGAGAGGTGAAACGTTAGCTTTAACAAGTAATTATTTGAAAGTAATGTTTTTAAGTGCACCTTTTGTAATT
TTGTTCTTCATATTAGAACAATTTGCACGTGCAATTGGGGCACCAATGGTTTCTATGATTGGTATGTTAGCTAGTGTAGGCTTAAATATT
ATTTTAGATCCAATTTTAATTTTTGGTTTTGATTTAAACGTTGTTGGTGCAGCTTTGGGTACTGCAATCAGTAATGTTGCTGCTGCTCTG
TTCTTTATCATTTATTTTATGAAAAATAGTGACGTTGTGTCAGTTAATATTAAACTTGCGAAACCTAATAAAGAAATGCTTTCTGAAATC
TTTAAAATCGGTATTCCTGCATTTTTAATGAGTATCTTAATGGGATTCACAGGATTAGTTTTAAATTTATTTTTAGCACATTATGGAAAC
TTCGCGATTGCAAGTTATGGTATCTCATTTAGACTTGTGCAATTTCCAGAACTTATTATCATGGGATTATGTGAAGGTGTTGTACCACTA
ATTGCATATAACTTTATGGCAAATAAAGGCCGTATGAAAGACGTTATCAAAGCAGTTATCATGTCTATCGGCGTTATCTTTGTTGTATGT
ATGAGTGCTGTATTTACAATTGGACATCATATGGTCGGACTATTTACTACTGATCAAGCCATTGTTGAGATGGCGACATTTATTTTGAAA
GTAACAATGGCATCATTATTATTAAATGGTATAGGTTTCTTGTTTACTGGTATGCTTCAAGCGACTGGGCAAGGTCGTGGTGCTACAATT
ATGGCCATTTTACAAGGTGCAATTATCATTCCAGTATTATTTATTATGAATGCTTTGTTTGGACTAACAGGTGTCATTTGGTCATTATTA
ATTGCTGAGTCACTTTGTGCTTTAGCAGCAATGTTAATCGTCTATTTATTACGTGATCGTTTGACAGTTGATACATCTGAATTAATAGAA
GGTTAA