mepR

Accession ARO:3000746
CARD Short NamemepR
DefinitionMepR is an upstream repressor of MepA in Staphylococcus aureus. It is part of the mepRAB operon.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Efflux Regulatorprotein(s) and two-component regulatory system modulating antibiotic efflux
Resistomes with Perfect MatchesStaphylococcus aureusg+p+wgs
Resistomes with Sequence VariantsEscherichia coliwgs, Klebsiella pneumoniaewgs, Staphylococcus aureusg+p+wgs, Staphylococcus epidermidiswgs
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

McAleese F, et al. 2005. Antimicrob Agents Chemother 49(5): 1865-1871. A novel MATE family efflux pump contributes to the reduced susceptibility of laboratory-derived Staphylococcus aureus mutants to tigecycline. (PMID 15855508)

Kaatz GW, et al. 2006. Antimicrob Agents Chemother 50(4): 1276-1281. MepR, a repressor of the Staphylococcus aureus MATE family multidrug efflux pump MepA, is a substrate-responsive regulatory protein. (PMID 16569840)

Kaatz GW, et al. 2005. Antimicrob Agents Chemother 49(5): 1857-1864. Multidrug resistance in Staphylococcus aureus due to overexpression of a novel multidrug and toxin extrusion (MATE) transport protein. (PMID 15855507)

Resistomes

Prevalence of mepR among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.02%0%
Klebsiella pneumoniae0%0%0.01%0%
Staphylococcus aureus99.63%0.12%61.13%0%
Staphylococcus epidermidis0%0%0.1%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 250


>gb|BAB56495.1|+|mepR [Staphylococcus aureus subsp. aureus Mu50]
MEFTYSYLFRMISHEMKQKADQKLEQFDITNEQGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKN
IGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ


>gb|BA000017.4|+|379932-380351|mepR [Staphylococcus aureus subsp. aureus Mu50]
ATGGAATTCACTTATTCGTATTTATTTAGAATGATTAGTCATGAGATGAAACAAAAGGCTGATCAAAAGTTAGAGCAATTTGATATTACA
AATGAGCAAGGTCATACGTTAGGTTATCTTTATGCACATCAACAAGATGGACTGACACAAAATGATATTGCTAAAGCATTACAACGAACA
GGTCCAACTGTCAGTAATTTATTAAGGAACCTTGAACGTAAAAAGCTGATCTATCGCTATGTCGATGCACAAGATACGAGAAGAAAGAAT
ATAGGACTGACTACCTCTGGGATTAAACTTGTAGAAGCATTCACTTCGATATTTGATGAAATGGAGCAAACACTCGTATCGCAGTTATCT
GAAGAAGAAAATGAACAAATGAAAGCAAACTTAACTAAAATGTTATCTAGTTTACAATAA