QepA1

Accession ARO:3000448
Synonym(s)QepA
CARD Short NameQepA1
DefinitionQepA1 is a plasmid-mediated efflux pump in E. coli, shown to contribute to fluoroquinolone resistance. It is regulated by sox genes, also known as global stress regulators.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Sequence VariantsEscherichia coliwgs, Shigella flexneriwgs
Classification7 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Sub-Term(s)
1 ontology terms | Show
+ soxRS regulates
Publications

Yamane K, et al. 2007. Antimicrob Agents Chemother 51(9): 3354-3360. New plasmid-mediated fluoroquinolone efflux pump, QepA, found in an Escherichia coli clinical isolate. (PMID 17548499)

Resistomes

Prevalence of QepA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Escherichia coli0%0%0.08%0%
Shigella flexneri0%0%0.16%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 900


>gb|AEZ36150.1|+|QepA1 [Klebsiella aerogenes]
MSATLHDTAADRRKATRREWIGLAVVALPCLVYAMDLTVLNLALPVLSRELQPSSAQLLWILDIYGFFVAGFLITMGTLGDRIGRRRLLL
IGAAFFAFASVLAALADTAALLIAARALLGLAGATIAPSTMALVRNMFHDPRQRQFAIGVWIAAFSLGSAIGPLVGGVLLEFFHWGAVFW
LNVPVMLLTLALGPRFLPEYRDPDAGHLDLASVLLSLAAVLLTIYGLKQLAEHGEGLASMAALLAGLAVGALFLRRQGHIAYPLLDLRLF
AHALFRAALAAYALAALAMFGVYIFMTQYLQLVLGLSPLQAGLATLPCSLCFVIGSLLSPQLAARWPAARILVVGLSAAAFGFAVLGLGQ
GLWWLVPATIVKGLGLAPVFTIGNEIIITSAPSERAGAASALSETVSEFSGALGIALFGSVGLVVYRQALTSAALPGLPADALQTAGASL
GGAVHLADTLPAWQGAALLAAARAGFTDALQATAWAGAVLVLVAAGLVARLLRKRPALASG


>gb|JQ064560.1|+|1-1536|QepA1 [Klebsiella aerogenes]
ATGTCCGCCACGCTCCACGACACCGCAGCGGATCGTCGGAAGGCCACCCGCCGCGAATGGATCGGCCTGGCCGTGGTCGCCCTGCCGTGC
CTGGTCTACGCCATGGACCTCACGGTGCTGAACCTGGCGCTGCCGGTGCTCAGCCGTGAACTGCAGCCCTCCAGCGCCCAGCTTCTCTGG
ATCCTGGACATCTACGGCTTCTTCGTCGCCGGCTTCCTGATCACCATGGGCACGCTGGGCGACCGCATCGGCCGGCGCCGGCTGTTGTTG
ATCGGCGCGGCGTTCTTCGCATTCGCCTCGGTGCTCGCGGCGCTGGCCGATACCGCCGCGCTGTTGATCGCGGCGCGCGCCTTGCTCGGC
CTGGCCGGCGCCACCATCGCGCCGTCCACCATGGCGCTGGTCCGCAACATGTTCCACGACCCGCGCCAGCGCCAGTTCGCCATCGGCGTG
TGGATCGCCGCGTTTTCGCTGGGCAGCGCGATCGGTCCGCTGGTCGGCGGCGTGTTGCTGGAGTTCTTCCACTGGGGCGCCGTGTTCTGG
CTCAACGTGCCGGTGATGCTGCTGACGCTGGCGCTCGGCCCTCGCTTCCTGCCCGAGTATCGTGATCCGGACGCGGGGCACCTGGACCTG
GCCAGCGTGCTGCTGTCGCTGGCGGCGGTGCTGCTGACGATCTACGGGCTCAAGCAGTTGGCCGAGCATGGAGAGGGCCTCGCCTCGATG
GCTGCGCTGCTGGCCGGGCTGGCGGTCGGGGCGCTGTTCCTGCGCCGCCAGGGCCACATCGCCTACCCGCTGCTGGACCTGCGGCTGTTC
GCGCACGCGCTGTTCCGCGCGGCGCTGGCGGCGTATGCGCTGGCCGCGCTGGCCATGTTCGGCGTCTACATCTTCATGACGCAGTACCTG
CAGCTCGTGCTGGGGCTGTCGCCGCTGCAGGCCGGGCTGGCCACGCTGCCCTGCTCCCTGTGCTTCGTCATCGGTTCGCTGTTGTCGCCG
CAGCTCGCGGCGCGCTGGCCGGCGGCGCGCATCCTCGTCGTGGGCCTGTCGGCAGCGGCGTTCGGCTTCGCCGTGCTGGGGCTGGGGCAG
GGCCTGTGGTGGCTGGTGCCGGCCACGATCGTCAAGGGCCTGGGCCTGGCGCCGGTGTTCACCATCGGCAACGAGATCATCATCACCAGC
GCGCCGTCCGAGCGCGCGGGCGCGGCCTCGGCCTTGTCGGAGACGGTGTCCGAATTCAGCGGCGCGCTGGGCATCGCGCTGTTCGGCAGC
GTCGGCCTGGTGGTCTACCGGCAGGCGCTGACCAGCGCGGCGCTGCCCGGCCTGCCGGCCGATGCGCTGCAGACGGCCGGTGCCTCGCTC
GGGGGCGCCGTGCACCTGGCCGACACCCTGCCGGCGTGGCAGGGCGCGGCCTTGCTGGCGGCCGCACGCGCGGGCTTCACCGATGCGCTG
CAGGCCACGGCCTGGGCCGGCGCGGTGCTGGTGCTGGTGGCCGCTGGGCTGGTGGCGCGCCTGCTGCGCAAGCGCCCAGCGCTCGCATCT
GGTTGA