abeS

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000768
CARD Short NameabeS
DefinitionAbeS in an efflux pump of the SMR family of transporters found in Acinetobacter baumannii.
AMR Gene Familysmall multidrug resistance (SMR) antibiotic efflux pump
Drug Classaminocoumarin antibiotic, macrolide antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONAcinetobacter baumannii (2)
GAZ
FOODON
ENVO
UBERON
Classification8 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ small multidrug resistance (SMR) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic novobiocin [Antibiotic]
Resistomes with Perfect MatchesAcinetobacter baumanniig+p+wgs, Acinetobacter nosocomialisg+wgs, Enterobacter asburiaewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter calcoaceticusg+wgs, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiig+wgs, Enterobacter asburiaewgs
Publications

Srinivasan VB, et al. 2009. Antimicrob Agents Chemother 53(12): 5312-5316. Role of AbeS, a novel efflux pump of the SMR family of transporters, in resistance to antimicrobial agents in Acinetobacter baumannii. (PMID 19770280)

Resistomes

Prevalence of abeS among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii98.76%0.16%99.09%0%0%
Acinetobacter calcoaceticus100%0%95.65%0%0%
Acinetobacter nosocomialis100%0%99.43%0%0%
Acinetobacter pittii100%0%99.72%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 175


>gb|ACJ59254.1|-|abeS [Acinetobacter baumannii AB307-0294]
MSYLYLAIAIACEVIATSALKASQGFTVPIPSIITVVGYAVAFYLLSLTLKTIPIGIAYAIWSGAGIILISAIGWIFYKQHLDLAACIGL
ALMIAGIVIINVFSKNTHL


>gb|CP001172.1|-|1249019-1249348|abeS [Acinetobacter baumannii AB307-0294]
ATGTCTTATCTTTATTTAGCAATTGCGATTGCTTGTGAAGTTATTGCAACTTCAGCATTAAAAGCATCTCAAGGTTTTACTGTTCCAATT
CCGTCTATTATTACAGTTGTGGGTTATGCAGTTGCTTTTTATTTATTATCTCTTACGCTCAAAACAATTCCAATCGGGATTGCCTATGCC
ATTTGGTCAGGCGCAGGTATTATTTTAATTTCTGCAATTGGCTGGATATTTTACAAACAACATTTAGACTTAGCTGCCTGCATTGGTTTA
GCTTTAATGATCGCAGGCATTGTGATTATTAATGTGTTTTCTAAAAACACCCATCTATAA

Curator Acknowledgements
Curator Description Most Recent Edit