OXA-9

Accession ARO:3001404
CARD Short NameOXA-9
DefinitionOXA-9 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyOXA beta-lactamase, OXA-9-like beta-lactamase
Drug Classpenam
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Alcaligenes faecaliswgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosag+wgs+gi, Pseudomonas putidawgs, Raoultella planticolap, Salmonella entericap+wgs, Serratia marcescensg+p+wgs, Shigella flexnerip, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Alcaligenes faecaliswgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter youngaewgs, Enterobacter asburiaeg+p+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Proteus mirabiliswgs, Providencia stuartiip, Pseudomonas aeruginosag+wgs+gi, Pseudomonas putidawgs, Raoultella planticolap, Salmonella entericap+wgs, Serratia marcescensg+p+wgs, Shigella flexnerip, Vibrio choleraewgs
Classification14 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ OXA-9-like beta-lactamase [AMR Gene Family]
Publications

Bojorquez D, et al. 1998. Cell Mol Biol (Noisy-le-grand) 44(3): 483-491. Characterization of OXA-9, a beta-lactamase encoded by the multiresistance transposon Tn1331. (PMID 9620445)

Resistomes

Prevalence of OXA-9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.03%0%
Aeromonas caviae0%0%0.54%0%
Alcaligenes faecalis0%0%2.94%0%
Citrobacter freundii0%0.62%1.93%0%
Citrobacter portucalensis0%0%0.9%0%
Citrobacter youngae0%0%6.25%0%
Enterobacter asburiae3.23%0.28%0.79%0%
Enterobacter chengduensis0%0%8%0%
Enterobacter cloacae0%0%1.92%0%
Enterobacter hormaechei0%0.13%5.96%0%
Enterobacter kobei0%0%1.31%0%
Enterobacter roggenkampii0%0%1.08%0%
Escherichia coli0%0.08%0.14%0%
Klebsiella aerogenes0%0%3.11%0%
Klebsiella michiganensis0%0%2.39%0%
Klebsiella oxytoca0%2.74%0%0%
Klebsiella pneumoniae0.24%0.93%4.83%0%
Klebsiella quasipneumoniae0.84%0.21%1.58%0%
Proteus mirabilis0%0%0.17%0%
Providencia stuartii0%6.82%0%0%
Pseudomonas aeruginosa0.61%0%0.63%1.39%
Pseudomonas putida0%0%0.53%0%
Raoultella planticola0%2.33%0%0%
Salmonella enterica0%0.11%0.04%0%
Serratia marcescens1.52%1.94%0.92%0%
Shigella flexneri0%0.4%0%0%
Vibrio cholerae0%0%0.13%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|AAA98406.1|+|OXA-9 [Klebsiella pneumoniae]
MKKILLLHMLVFVSATLPISSVASDEVETLKCTIIADAITGNTLYETGECARRVSPCSSFKLPLAIMGFDSGILQSPKSPTWELKPEYNP
SPRDRTYKQVYPALWQSDSVVWFSQQLTSRLGVDRFTEYVKKFEYGNQDVSGDSGKHNGLTQSWLMSSLTISPKEQIQFLLRFVAHKLPV
SEAAYDMAYATIPQYQAAEGWAVHGKSGSGWLRDNNGKINESRPQGWFVGWAEKNGRQVVFARLEIGKEKSDIPGGSKAREDILVELPVL
MGNK


>gb|M55547.1|+|1-825|OXA-9 [Klebsiella pneumoniae]
ATGAAAAAAATTTTGCTGCTGCATATGTTGGTGTTCGTTTCCGCCACTCTCCCAATCAGTTCCGTGGCTTCTGATGAGGTTGAAACGCTT
AAATGCACCATCATCGCAGACGCCATTACCGGAAATACCTTATATGAGACCGGAGAATGTGCCCGTCGTGTGTCTCCGTGCTCGTCTTTT
AAACTTCCATTGGCAATCATGGGGTTTGATAGTGGAATCTTGCAGTCGCCAAAATCACCTACGTGGGAATTGAAGCCGGAATACAACCCG
TCTCCGAGAGATCGCACATACAAACAAGTCTATCCGGCGCTATGGCAAAGCGACTCTGTTGTCTGGTTCTCGCAGCAATTAACAAGCCGT
CTGGGAGTTGATCGGTTCACGGAATACGTAAAGAAATTTGAGTACGGTAATCAAGATGTTTCCGGTGACTCGGGGAAGCATAACGGCTTG
ACCCAGTCATGGCTGATGTCGTCGCTCACCATATCTCCCAAGGAGCAAATTCAGTTTCTTCTACGCTTTGTCGCGCATAAGCTGCCTGTA
TCCGAAGCGGCTTATGACATGGCGTATGCCACAATCCCGCAGTACCAGGCAGCCGAAGGATGGGCTGTACATGGAAAAAGCGGCAGCGGC
TGGCTTCGGGACAATAACGGCAAGATAAATGAAAGTCGTCCGCAGGGCTGGTTCGTGGGCTGGGCTGAAAAAAACGGACGGCAAGTTGTT
TTCGCCCGATTGGAAATAGGAAAGGAAAAGTCCGATATTCCCGGCGGGTCTAAAGCACGAGAGGATATTCTCGTGGAATTACCCGTGTTG
ATGGGTAACAAATGA