OXA-9

Accession ARO:3001404
DefinitionOXA-9 is a beta-lactamase found in Klebsiella pneumoniae.
AMR Gene FamilyOXA beta-lactamase
Drug Classpenam, cephalosporin, carbapenem
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Alcaligenes faecaliswgs, Citrobacter freundiip+wgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+wgs+gi, Raoultella planticolap, Salmonella entericap+wgs, Serratia marcescensg+p+wgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Alcaligenes faecaliswgs, Citrobacter freundiip+wgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella oxytocap, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Pseudomonas aeruginosag+wgs+gi, Raoultella planticolap, Salmonella entericap+wgs, Serratia marcescensg+p+wgs, Vibrio choleraewgs
Classification15 ontology terms | Show
Parent Term(s)1 ontology terms | Show
+ OXA beta-lactamase [AMR Gene Family]
Publications

Bojorquez D, et al. 1998. Cell Mol Biol (Noisy-le-grand) 44(3): 483-491. Characterization of OXA-9, a beta-lactamase encoded by the multiresistance transposon Tn1331. (PMID 9620445)

Resistomes

Prevalence of OXA-9 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.07%0%
Aeromonas caviae0%0%2.5%0%
Alcaligenes faecalis0%0%5.26%0%
Citrobacter freundii0%1.61%4.37%0%
Citrobacter youngae0%0%7.14%0%
Enterobacter asburiae0%0%1.69%0%
Enterobacter chengduensis0%0%20%0%
Enterobacter cloacae0%0.84%5.33%0%
Enterobacter hormaechei0%0.41%10.83%0%
Enterobacter kobei0%1.45%2.13%0%
Enterobacter roggenkampii0%0.68%2.63%0%
Escherichia coli0%0.16%0.07%0%
Klebsiella michiganensis0%0%5.99%0%
Klebsiella oxytoca0%1.67%0%0%
Klebsiella pneumoniae0.34%2.27%23.24%0%
Klebsiella quasipneumoniae0%1.33%2.61%0%
Proteus mirabilis0%0%1.03%0%
Pseudomonas aeruginosa0.52%0%0.8%1.39%
Raoultella planticola0%4.35%0%0%
Salmonella enterica0%0.15%0.04%0%
Serratia marcescens1.94%2.17%2.35%0%
Vibrio cholerae0%0%0.17%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 500


>gb|AAA98406.1|+|OXA-9 [Klebsiella pneumoniae]
MKKILLLHMLVFVSATLPISSVASDEVETLKCTIIADAITGNTLYETGECARRVSPCSSFKLPLAIMGFDSGILQSPKSPTWELKPEYNP
SPRDRTYKQVYPALWQSDSVVWFSQQLTSRLGVDRFTEYVKKFEYGNQDVSGDSGKHNGLTQSWLMSSLTISPKEQIQFLLRFVAHKLPV
SEAAYDMAYATIPQYQAAEGWAVHGKSGSGWLRDNNGKINESRPQGWFVGWAEKNGRQVVFARLEIGKEKSDIPGGSKAREDILVELPVL
MGNK


>gb|M55547|+|1-825|OXA-9 [Klebsiella pneumoniae]
ATGAAAAAAATTTTGCTGCTGCATATGTTGGTGTTCGTTTCCGCCACTCTCCCAATCAGTTCCGTGGCTTCTGATGAGGTTGAAACGCTT
AAATGCACCATCATCGCAGACGCCATTACCGGAAATACCTTATATGAGACCGGAGAATGTGCCCGTCGTGTGTCTCCGTGCTCGTCTTTT
AAACTTCCATTGGCAATCATGGGGTTTGATAGTGGAATCTTGCAGTCGCCAAAATCACCTACGTGGGAATTGAAGCCGGAATACAACCCG
TCTCCGAGAGATCGCACATACAAACAAGTCTATCCGGCGCTATGGCAAAGCGACTCTGTTGTCTGGTTCTCGCAGCAATTAACAAGCCGT
CTGGGAGTTGATCGGTTCACGGAATACGTAAAGAAATTTGAGTACGGTAATCAAGATGTTTCCGGTGACTCGGGGAAGCATAACGGCTTG
ACCCAGTCATGGCTGATGTCGTCGCTCACCATATCTCCCAAGGAGCAAATTCAGTTTCTTCTACGCTTTGTCGCGCATAAGCTGCCTGTA
TCCGAAGCGGCTTATGACATGGCGTATGCCACAATCCCGCAGTACCAGGCAGCCGAAGGATGGGCTGTACATGGAAAAAGCGGCAGCGGC
TGGCTTCGGGACAATAACGGCAAGATAAATGAAAGTCGTCCGCAGGGCTGGTTCGTGGGCTGGGCTGAAAAAAACGGACGGCAAGTTGTT
TTCGCCCGATTGGAAATAGGAAAGGAAAAGTCCGATATTCCCGGCGGGTCTAAAGCACGAGAGGATATTCTCGTGGAATTACCCGTGTTG
ATGGGTAACAAATGA