dfrA1

Accession ARO:3002854
Synonym(s)dfr1
CARD Short NamedfrA1
DefinitiondfrA1 is an integron-encoded dihydrofolate reductase.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAeromonas hydrophilap, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Proteus mirabilisg+wgs, Providencia heimbachaep, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shigella dysenteriaep+wgs, Shigella flexneriwgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter lwoffiiwgs, Acinetobacter pittiip+wgs, Acinetobacter townerip+wgs, Aeromonas caviaewgs, Aeromonas hydrophilap, Aeromonas veroniiwgs, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiig+p+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Corynebacterium diphtheriaeg+wgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Pasteurella multocidawgs, Proteus columbaeg, Proteus mirabilisg+p+wgs, Proteus penneriwgs, Proteus vulgarisg+wgs, Providencia heimbachaeg+p+wgs, Providencia rettgerig+p+wgs, Providencia stuartiig+wgs, Pseudomonas aeruginosap+wgs, Pseudomonas stutzeriwgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiig+wgs, Shigella dysenteriaeg+p+wgs, Shigella flexnerig+wgs, Shigella sonneiwgs, Vibrio choleraeg+wgs, Vibrio parahaemolyticuswgs, Vibrio vulnificuswgs, Yersinia enterocoliticawgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Saenz Y, et al. 2004. Antimicrob Agents Chemother 48(10): 3996-4001. Mechanisms of resistance in multiple-antibiotic-resistant Escherichia coli strains of human, animal, and food origins. (PMID 15388464)

Resistomes

Prevalence of dfrA1 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii1.25%0.38%1.64%0%
Acinetobacter lwoffii0%0%4.76%0%
Acinetobacter pittii0%0.57%0.74%0%
Acinetobacter towneri0%9.09%5.26%0%
Aeromonas caviae0%0%0.9%0%
Aeromonas hydrophila0%2.78%0%0%
Aeromonas veronii0%0%0.79%0%
Alcaligenes faecalis0%0%21.74%0%
Citrobacter amalonaticus0%0%2.08%0%
Citrobacter freundii9.23%0.26%12.15%0%
Citrobacter portucalensis0%0%10%0%
Citrobacter werkmanii0%0%9.52%0%
Corynebacterium diphtheriae3.45%0%0.39%0%
Enterobacter asburiae0%0%2.08%0%
Enterobacter cloacae0%0%7.27%0%
Enterobacter hormaechei0.6%2.04%6.37%0%
Enterobacter kobei0%0%6.56%0%
Enterobacter roggenkampii0%0%2.42%0%
Escherichia albertii0%0%1.15%0%
Escherichia coli1.29%0.43%4.74%0%
Escherichia fergusonii0%0.8%1.54%0%
Klebsiella aerogenes0%2.9%0.63%0%
Klebsiella michiganensis0%2.4%0.65%0%
Klebsiella oxytoca0%0%8.76%0%
Klebsiella pneumoniae0%1.12%4.83%0%
Klebsiella quasipneumoniae0%0.82%3.76%0%
Morganella morganii18.37%0%7.64%0%
Pasteurella multocida0%0%1.05%0%
Proteus columbae100%0%0%0%
Proteus mirabilis45%4.84%32.41%0%
Proteus penneri0%0%16.67%0%
Proteus vulgaris22.22%0%20%0%
Providencia heimbachae50%100%33.33%0%
Providencia rettgeri48.28%6.06%20.69%0%
Providencia stuartii18.18%0%16.28%0%
Pseudomonas aeruginosa0%0.34%0.18%0%
Pseudomonas stutzeri0%0%5.1%0%
Raoultella planticola0%2.27%2.94%0%
Salmonella enterica0.91%0.69%1.43%0%
Serratia marcescens0%0.71%5.9%0%
Shewanella putrefaciens0%25%0%0%
Shigella boydii14.29%0%22.58%0%
Shigella dysenteriae9.09%5.56%21.43%0%
Shigella flexneri26.32%0%58.82%0%
Shigella sonnei0%0%74.54%0%
Vibrio cholerae6.47%0%31.4%0%
Vibrio parahaemolyticus0%0%0.13%0%
Vibrio vulnificus0%0%0.43%0%
Yersinia enterocolitica0%0%0.55%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AAP74961.2|+|dfrA1 [Klebsiella oxytoca]
MKLSLMVAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSDNENVVIFPSIKDALTNLKKI
TDHVIVSGGGEIYKSLIDQVDTLHISTIDIEPEGDVYFPEIPSNFRPVFTQDFASNINYSYQIWQKG


>gb|KJ541681.1|+|19527-20000|dfrA1 [Klebsiella oxytoca]
GTGAAACTATCACTAATGGTAGCTATATCGAAGAATGGAGTTATCGGGAATGGCCCTGATATTCCATGGAGTGCCAAAGGTGAACAGCTC
CTGTTTAAAGCTATTACCTATAACCAATGGCTGTTGGTTGGACGCAAGACTTTTGAATCAATGGGAGCATTACCCAACCGAAAGTATGCG
GTCGTAACACGTTCAAGTTTTACATCTGACAATGAGAACGTAGTGATCTTTCCATCAATTAAAGATGCTTTAACCAACCTAAAGAAAATA
ACGGATCATGTCATTGTTTCAGGTGGTGGGGAGATATACAAAAGCCTGATCGATCAAGTAGATACACTACATATATCTACAATAGACATC
GAGCCGGAAGGTGATGTTTACTTTCCTGAAATCCCCAGCAATTTTAGGCCAGTTTTTACCCAAGACTTCGCCTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA