dfrA12

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002858
CARD Short NamedfrA12
DefinitiondfrA12 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs+gi, Acinetobacter indicusg, Aeromonas caviaep+wgs, Aeromonas hydrophilawgs, Aeromonas veroniig+p+wgs+gi, Bordetella trematumgi, Citrobacter freundiig+p+wgs, Citrobacter koserig, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Cronobacter malonaticuswgs, Edwardsiella tardag+wgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs, Klebsiella aerogenesg+p+wgs+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg, Providencia rettgerip+wgs, Providencia stuartiig+p+wgs+gi, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneig+wgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs+gi, Acinetobacter indicusg, Aeromonas caviaep+wgs, Aeromonas hydrophilawgs, Aeromonas veroniig+p+wgs+gi, Bordetella trematumgi, Citrobacter freundiig+p+wgs, Citrobacter koserig, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaep+wgs, Cronobacter malonaticuswgs, Edwardsiella tardag+wgs, Enterobacter asburiaewgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia albertiig+wgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniig+p+wgs, Klebsiella aerogenesg+p+wgs+gi, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaep+wgs, Laribacter hongkongensiswgs, Leclercia adecarboxylatawgs, Morganella morganiig+wgs+gi, Proteus mirabilisg+p+wgs+gi, Proteus penneriwgs, Proteus vulgarisp+wgs, Providencia alcalifaciensg, Providencia rettgerip+wgs, Providencia stuartiig+p+wgs+gi, Pseudomonas aeruginosawgs, Raoultella planticolawgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneig+wgs, Vibrio choleraewgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Thungapathra M, et al. 2002. Antimicrob Agents Chemother 46(9): 2948-2955. Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. (PMID 12183252)

Miriagou V, et al. 2010. Antimicrob. Agents Chemother. 54(10):4497-502 Sequence of pNL194, a 79.3-kilobase IncN plasmid carrying the blaVIM-1 metallo-beta-lactamase gene in Klebsiella pneumoniae. (PMID 20660690)

Resistomes

Prevalence of dfrA12 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0.16%1.26%0%
Acinetobacter indicus4.76%0%0%0%0%
Aeromonas caviae0%1.3%9.68%0%0%
Aeromonas hydrophila0%0%4.84%0%0%
Aeromonas veronii5.45%3.08%2.81%12.5%0%
Bordetella trematum0%0%0%50%0%
Citrobacter freundii1.64%1.85%16.25%0%0%
Citrobacter koseri6.25%0%0%0%0%
Citrobacter portucalensis0%4.41%22.52%0%0%
Citrobacter werkmanii0%0%66.67%0%0%
Citrobacter youngae0%9.09%6.25%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Edwardsiella tarda10%0%6.67%0%0%
Enterobacter asburiae0%0%0.79%0%0%
Enterobacter chengduensis0%0%8%0%0%
Enterobacter cloacae0%1.12%3.83%0%0%
Enterobacter hormaechei0.36%1.29%5.48%0%0%
Enterobacter kobei0%0.69%2.62%0%0%
Enterobacter roggenkampii0%0%1.44%0%0%
Escherichia albertii1.43%0%1.94%0%0%
Escherichia coli0.86%2.02%9.64%1.02%0.89%
Escherichia fergusonii1.64%2.49%4.35%0%0%
Klebsiella aerogenes4%3.26%1.13%25%0%
Klebsiella michiganensis0%1.71%0.8%0%0%
Klebsiella oxytoca0%1.37%3.36%0%0%
Klebsiella pneumoniae1.24%3.89%21.83%3.81%0%
Klebsiella quasipneumoniae0%2.12%13.29%0%0%
Laribacter hongkongensis0%0%2.08%0%0%
Leclercia adecarboxylata0%0%39.53%0%0%
Morganella morganii15.38%0%9.2%23.08%0%
Proteus mirabilis15.6%7.5%10.4%14.81%0%
Proteus penneri0%0%12.5%0%0%
Proteus vulgaris0%11.11%5.56%0%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri0%2.7%5.1%0%0%
Providencia stuartii12.5%2.27%2.27%33.33%0%
Pseudomonas aeruginosa0%0%0.06%0%0%
Raoultella planticola0%0%2.56%0%0%
Salmonella enterica1.64%4.81%2.74%2.98%0%
Shigella boydii0%0%4.44%0%0%
Shigella dysenteriae0%0%3.33%0%0%
Shigella flexneri1%6.83%1.24%0%0%
Shigella sonnei2.44%0%1.9%0%0%
Vibrio cholerae0%0%0.51%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ADG84870.1|-|dfrA12 [Klebsiella pneumoniae]
MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGKVVVMGRKTFESIGKPLPNRHTLVISRQANYRATGCVVVSTLSHAIA
LASELGNELYVAGGAEIYTLALPHAHGVFLSEVHQTFEGDAFFPMLNETEFELVSTETIQAVIPYTHSVYARRNG


>gb|GU585907.1|-|21606-22103|dfrA12 [Klebsiella pneumoniae]
ATGAACTCGGAATCAGTACGCATTTATCTCGTTGCTGCGATGGGAGCCAATCGGGTTATTGGCAATGGTCCTAATATCCCCTGGAAAATT
CCGGGTGAGCAGAAGATTTTTCGCAGACTCACTGAGGGAAAAGTCGTTGTCATGGGGCGAAAGACCTTTGAGTCTATCGGCAAGCCTCTA
CCGAACCGTCACACATTGGTAATCTCACGCCAAGCTAACTACCGCGCCACTGGCTGCGTAGTTGTTTCAACGCTGTCGCACGCTATCGCT
TTGGCATCCGAACTCGGCAATGAACTCTACGTCGCGGGCGGAGCTGAGATATACACTCTGGCACTACCTCACGCCCACGGCGTGTTTCTA
TCTGAGGTACATCAAACCTTCGAGGGTGACGCCTTCTTCCCAATGCTCAACGAAACAGAATTCGAGCTTGTCTCAACCGAAACCATTCAA
GCTGTAATTCCGTACACCCACTCCGTTTATGCGCGTCGAAACGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit