dfrA14

Accession ARO:3002859
CARD Short NamedfrA14
DefinitiondfrA14 is an integron-encoded dihydrofolate reductase found in Escherichia coli.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAeromonas hydrophilap, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiip+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaegi, Aeromonas hydrophilap, Aeromonas veroniip+wgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaep+wgs+gi, Enterobacter hormaecheig+p+wgs+gi, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Histophilus somniwgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatap, Morganella morganiip+wgs, Pasteurella multocidawgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidap, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs, Yersinia enterocoliticawgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Marquez C, et al. 2008. Antimicrob Agents Chemother 52(11): 4153-4154. Recovery of a functional class 2 integron from an Escherichia coli strain mediating a urinary tract infection. (PMID 18794381)

Resistomes

Prevalence of dfrA14 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.04%0%
Aeromonas caviae0%0%0%33.33%
Aeromonas hydrophila0%5.56%0%0%
Aeromonas veronii0%2.86%0.79%0%
Citrobacter amalonaticus0%0%8.33%0%
Citrobacter freundii0%1.3%7.34%0%
Citrobacter portucalensis5.56%0%8%0%
Citrobacter werkmanii0%0%4.76%0%
Citrobacter youngae0%0%14.29%0%
Enterobacter asburiae0%2.27%4.17%0%
Enterobacter chengduensis0%0%9.09%0%
Enterobacter cloacae0%5.88%14.55%10%
Enterobacter hormaechei2.38%4.92%19%3.33%
Enterobacter kobei0%0%6.56%0%
Enterobacter roggenkampii0%0.66%7.27%0%
Escherichia albertii0%2.63%0%0%
Escherichia coli0.23%1.21%4.25%0%
Escherichia fergusonii0%2.41%12.31%0%
Histophilus somni0%0%37.5%0%
Klebsiella aerogenes0%0%3.14%0%
Klebsiella michiganensis0%0.8%8.77%0%
Klebsiella oxytoca0%3.81%6.45%0%
Klebsiella pneumoniae0%4.07%19.59%0%
Klebsiella quasipneumoniae0%3.27%16.31%0%
Leclercia adecarboxylata0%3.85%0%0%
Morganella morganii0%5.41%1.39%0%
Pasteurella multocida0%0%0.53%0%
Proteus mirabilis2.5%8.06%2.41%0%
Proteus vulgaris0%12.5%0%0%
Providencia rettgeri0%0%11.21%0%
Providencia stuartii0%4.35%6.98%0%
Pseudomonas aeruginosa0%0%0.12%0%
Pseudomonas putida0%5%0%0%
Raoultella planticola0%4.55%5.88%0%
Salmonella enterica0.08%2.49%1.78%0.33%
Serratia marcescens0%1.42%3.18%0%
Shewanella putrefaciens0%25%0%0%
Shigella boydii0%0%16.13%0%
Shigella dysenteriae0%0%3.57%0%
Shigella flexneri0%8.7%9.48%0%
Shigella sonnei0%0%7.62%0%
Vibrio cholerae0%0%0.07%0%
Yersinia enterocolitica0%0%1.1%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AHK10285.1|+|dfrA14 [Escherichia coli]
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEF
TGHVIVSGGGEIYRETLPMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG


>gb|KF921535.1|+|618-1091|dfrA14 [Escherichia coli]
TTGAAAGTATCATTGATGGCTGCGAAAGCGAAAAACGGCGTGATTGGTTGCGGTCCAGACATACCCTGGTCCGCGAAAGGGGAGCAGCTA
CTTTTTAAAGCATTGACCTACAATCAGTGGCTTCTGGTGGGTCGCAAGACGTTTGAATCTATGGGCGCACTCCCCAATAGGAAATACGCG
GTCGTTACCCGCTCAGGTTGGACATCAAATGATGACAATGTAGTTGTATTTCAGTCAATCGAAGAGGCCATGGACAGGCTAGCTGAATTC
ACCGGTCACGTTATAGTGTCTGGTGGCGGAGAAATTTACCGAGAAACATTACCCATGGCCTCTACGCTCCACTTATCGACGATCGACATC
GAGCCAGAGGGGGATGTTTTCTTCCCGAGTATTCCAAATACCTTCGAAGTTGTTTTTGAGCAACACTTTACTTCAAACATTAACTATTGC
TATCAAATTTGGAAAAAGGGTTAA