dfrA14

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002859
CARD Short NamedfrA14
DefinitiondfrA14 is an integron-encoded dihydrofolate reductase found in Escherichia coli.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (3)
GAZ
FOODON
ENVO
UBERON
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniig, Aeromonas caviaewgs, Aeromonas hydrophilap, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Cronobacter sakazakiip, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+wgs, Morganella morganiip+wgs, Proteus mirabilisp+wgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosawgs, Raoultella planticolap+wgs, Salmonella entericag+p+wgs, Serratia marcescenswgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneiwgs, Vibrio choleraewgs
Resistomes with Sequence VariantsAcinetobacter baumanniig, Aeromonas caviaewgs+gi, Aeromonas hydrophilap, Aeromonas veroniip+wgs, Citrobacter amalonaticuswgs, Citrobacter freundiip+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisg+wgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Cronobacter sakazakiip, Enterobacter asburiaep+wgs, Enterobacter chengduensiswgs, Enterobacter cloacaeg+p+wgs+gi, Enterobacter hormaecheig+p+wgs+gi, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia albertiip, Escherichia colig+p+wgs, Escherichia fergusoniip+wgs, Histophilus somniwgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisg+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Leclercia adecarboxylatag+p+wgs, Morganella morganiip+wgs, Pasteurella multocidawgs, Proteus mirabilisg+p+wgs, Proteus vulgarisp, Providencia rettgeriwgs, Providencia stuartiip+wgs, Pseudomonas aeruginosawgs, Pseudomonas putidap, Raoultella planticolap+wgs, Salmonella entericag+p+wgs+gi, Serratia marcescensp+wgs, Shewanella putrefaciensp, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerip+wgs, Shigella sonneip+wgs, Staphylococcus aureuswgs, Vibrio choleraewgs, Yersinia enterocoliticawgs
Publications

Marquez C, et al. 2008. Antimicrob Agents Chemother 52(11): 4153-4154. Recovery of a functional class 2 integron from an Escherichia coli strain mediating a urinary tract infection. (PMID 18794381)

Resistomes

Prevalence of dfrA14 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0%0%0%0%
Aeromonas caviae0%0%1.08%33.33%0%
Aeromonas hydrophila0%2.6%0%0%0%
Aeromonas veronii0%3.08%2.25%0%0%
Citrobacter amalonaticus0%0%14.55%0%0%
Citrobacter freundii0%1.23%9.09%0%0%
Citrobacter koseri0%5%2.7%0%0%
Citrobacter portucalensis3.7%0%5.41%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Cronobacter sakazakii0%2.56%0%0%0%
Enterobacter asburiae0%0.83%10.28%0%0%
Enterobacter chengduensis0%0%12%0%0%
Enterobacter cloacae1.79%6.15%14.38%10%0%
Enterobacter hormaechei1.8%2.7%23.82%3.33%0%
Enterobacter kobei0%0%4.8%0%0%
Enterobacter roggenkampii0%1.45%6.12%0%0%
Escherichia albertii0%0.56%0%0%0%
Escherichia coli0.24%1.62%6.57%0%1.99%
Escherichia fergusonii0%2.14%36.96%0%0%
Histophilus somni0%0%31.03%0%0%
Klebsiella aerogenes0%1.09%4.52%0%0%
Klebsiella michiganensis1.61%4%16.76%0%0%
Klebsiella oxytoca0%4.11%5.88%0%0%
Klebsiella pneumoniae0.18%5.27%26.47%0%0%
Klebsiella quasipneumoniae0%2.33%15.79%0%0%
Leclercia adecarboxylata7.14%4.76%2.33%0%0%
Morganella morganii0%5%1.84%0%0%
Pasteurella multocida0%0%0.37%0%0%
Proteus mirabilis2.75%6.25%1.65%0%0%
Proteus vulgaris0%11.11%0%0%0%
Providencia rettgeri0%0%8.92%0%0%
Providencia stuartii0%11.36%13.64%0%0%
Pseudomonas aeruginosa0%0%0.43%0%0%
Pseudomonas putida0%4%0%0%0%
Raoultella planticola0%4.65%5.13%0%0%
Salmonella enterica0.44%2.95%2.61%0.33%0%
Serratia marcescens0%1.29%2.88%0%0%
Shewanella putrefaciens0%20%0%0%0%
Shigella boydii0%0%14.44%0%0%
Shigella dysenteriae0%0%3.33%0%0%
Shigella flexneri0%9.24%9.63%0%0%
Shigella sonnei0%0.97%7.96%0%0%
Staphylococcus aureus0%0%0.01%0%0%
Vibrio cholerae0%0%0.13%0%0%
Yersinia enterocolitica0%0%0.91%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AHK10285.1|+|dfrA14 [Escherichia coli]
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEF
TGHVIVSGGGEIYRETLPMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG


>gb|KF921535.1|+|618-1091|dfrA14 [Escherichia coli]
TTGAAAGTATCATTGATGGCTGCGAAAGCGAAAAACGGCGTGATTGGTTGCGGTCCAGACATACCCTGGTCCGCGAAAGGGGAGCAGCTA
CTTTTTAAAGCATTGACCTACAATCAGTGGCTTCTGGTGGGTCGCAAGACGTTTGAATCTATGGGCGCACTCCCCAATAGGAAATACGCG
GTCGTTACCCGCTCAGGTTGGACATCAAATGATGACAATGTAGTTGTATTTCAGTCAATCGAAGAGGCCATGGACAGGCTAGCTGAATTC
ACCGGTCACGTTATAGTGTCTGGTGGCGGAGAAATTTACCGAGAAACATTACCCATGGCCTCTACGCTCCACTTATCGACGATCGACATC
GAGCCAGAGGGGGATGTTTTCTTCCCGAGTATTCCAAATACCTTCGAAGTTGTTTTTGAGCAACACTTTACTTCAAACATTAACTATTGC
TATCAAATTTGGAAAAAGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit