dfrA17

Accession ARO:3002860
DefinitiondfrA17 is an integron-encoded dihydrofolate reductase found in Escherichia coli
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
ResistomesEscherichia colip+wgs, Klebsiella oxytocawgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification10 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Sandalli C, et al. 2010. Microbiol Immunol 54(3): 164-169. Prevalence of integrons and a new dfrA17 variant in Gram-negative bacilli which cause community-acquired infections. (PMID 20236427)

Resistomes

Prevalence of dfrA17 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.04%
Burkholderia cenocepacia0%0%2.55%
Citrobacter freundii0%0%4.65%
Enterobacter cloacae0%0%0.45%
Enterobacter hormaechei0%1.8%0.48%
Escherichia coli0.07%2.07%7.07%
Klebsiella oxytoca0%0%2.8%
Klebsiella pneumoniae0%0%0%
Morganella morganii9.09%0%7.14%
Proteus mirabilis8.7%3.7%1.72%
Providencia rettgeri0%0%7.69%
Salmonella enterica0.39%0%0.08%
Shigella dysenteriae0%0%2.86%
Shigella flexneri0%4.26%7.01%
Shigella sonnei0%5.88%1.1%
Yersinia enterocolitica0%0%0.65%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|ABG91835.1|+|dfrA17 [Pseudomonas aeruginosa]
MKISLISAVSENGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSKNGISSSNENVLVFPSIENALKELSKV
TDHVYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG


>gb|DQ838665|+|1-474|dfrA17 [Pseudomonas aeruginosa]
TTGAAAATATCATTGATTTCTGCAGTGTCAGAAAATGGCGTAATCGGTAGTGGTCCTGATATCCCGTGGTCAGTAAAAGGTGAGCAACTA
CTCTTTAAAGCGCTCACATATAATCAATGGCTCCTTGTCGGAAGAAAAACATTTGACTCTATGGGTGTTCTTCCAAATCGCAAATATGCA
GTAGTGTCAAAGAACGGAATTTCAAGCTCAAATGAAAACGTCCTAGTTTTTCCTTCAATAGAAAATGCTTTGAAAGAGCTATCAAAAGTT
ACAGATCATGTATATGTCTCTGGCGGGGGTCAAATCTATAATAGCCTTATTGAAAAAGCAGATATAATTCATTTGTCTACTGTTCACGTT
GAAGTCGAAGGTGATATCAAATTCCCTATAATGCCTGAGAATTTCAATTTGGTTTTTGAACAGTTTTTTATGTCTAATATAAATTATACA
TACCAGATTTGGAAAAAAGGCTAA