dfrA17

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002860
CARD Short NamedfrA17
DefinitiondfrA17 is an integron-encoded dihydrofolate reductase found in Escherichia coli.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesCitrobacter freundiiwgs, Escherichia colig+p+wgs, Klebsiella aerogenesp, Klebsiella michiganensiswgs, Klebsiella pneumoniaewgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Salmonella entericawgs, Shigella boydiiwgs, Shigella flexnerig+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+wgs, Alcaligenes faecaliswgs, Burkholderia cenocepaciawgs, Citrobacter amalonaticusp, Citrobacter freundiiwgs, Citrobacter portucalensiswgs, Citrobacter werkmaniiwgs, Enterobacter asburiaep, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeig, Escherichia colig+p+wgs+gi, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisg+wgs, Klebsiella oxytocawgs, Klebsiella pneumoniaeg+p+wgs+gi, Klebsiella quasipneumoniaewgs, Laribacter hongkongensisgi, Morganella morganiig+wgs+gi, Pasteurella multocidawgs, Proteus mirabilisg+p+wgs+gi, Providencia alcalifaciensg, Providencia rettgerip+wgs, Salmonella entericag+p+wgs+gi, Shigella boydiiwgs, Shigella dysenteriaewgs, Shigella flexnerig+p+wgs, Shigella sonneip+wgs+gi, Vibrio parahaemolyticuswgs, Yersinia enterocoliticawgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Sandalli C, et al. 2010. Microbiol Immunol 54(3): 164-169. Prevalence of integrons and a new dfrA17 variant in Gram-negative bacilli which cause community-acquired infections. (PMID 20236427)

Resistomes

Prevalence of dfrA17 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.35%0%0.09%0%0%
Aeromonas hydrophila0%1.3%0.81%0%0%
Aeromonas veronii1.82%0%0.56%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Burkholderia cenocepacia0%0%1.54%0%0%
Citrobacter amalonaticus0%8.33%0%0%0%
Citrobacter freundii0%0%5.03%0%0%
Citrobacter portucalensis0%0%3.6%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Enterobacter asburiae0%0.28%0%0%0%
Enterobacter cloacae0%0%0.64%0%0%
Enterobacter hormaechei0%0.19%1.77%0%0%
Enterobacter kobei4.55%0%0%0%0%
Escherichia coli1.69%2.37%12.69%0.26%1.46%
Escherichia fergusonii0%0.36%9.78%0%0%
Klebsiella aerogenes0%1.09%0.85%0%0%
Klebsiella michiganensis9.68%0%1.33%0%0%
Klebsiella oxytoca0%0%3.78%0%0%
Klebsiella pneumoniae0.06%0.14%1.09%0.95%0%
Klebsiella quasipneumoniae0%0%0.66%0%0%
Laribacter hongkongensis0%0%0%50%0%
Morganella morganii5.77%0%8.59%7.69%0%
Pasteurella multocida0%0%0.37%0%0%
Proteus mirabilis11.01%1.25%8.42%18.52%0%
Providencia alcalifaciens9.09%0%0%0%0%
Providencia rettgeri0%2.7%0.64%0%0%
Salmonella enterica0.5%0.93%0.83%0.99%0%
Shigella boydii0%0%6.67%0%0%
Shigella dysenteriae0%0%3.33%0%0%
Shigella flexneri7%2.01%7.3%0%0%
Shigella sonnei0%4.85%1.46%4.76%0%
Vibrio parahaemolyticus0%0%0.1%0%0%
Yersinia enterocolitica0%0%0.45%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ABG91835.1|+|dfrA17 [Pseudomonas aeruginosa]
MKISLISAVSENGVIGSGPDIPWSVKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSKNGISSSNENVLVFPSIENALKELSKV
TDHVYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDIKFPIMPENFNLVFEQFFMSNINYTYQIWKKG


>gb|DQ838665.1|+|1-474|dfrA17 [Pseudomonas aeruginosa]
TTGAAAATATCATTGATTTCTGCAGTGTCAGAAAATGGCGTAATCGGTAGTGGTCCTGATATCCCGTGGTCAGTAAAAGGTGAGCAACTA
CTCTTTAAAGCGCTCACATATAATCAATGGCTCCTTGTCGGAAGAAAAACATTTGACTCTATGGGTGTTCTTCCAAATCGCAAATATGCA
GTAGTGTCAAAGAACGGAATTTCAAGCTCAAATGAAAACGTCCTAGTTTTTCCTTCAATAGAAAATGCTTTGAAAGAGCTATCAAAAGTT
ACAGATCATGTATATGTCTCTGGCGGGGGTCAAATCTATAATAGCCTTATTGAAAAAGCAGATATAATTCATTTGTCTACTGTTCACGTT
GAAGTCGAAGGTGATATCAAATTCCCTATAATGCCTGAGAATTTCAATTTGGTTTTTGAACAGTTTTTTATGTCTAATATAAATTATACA
TACCAGATTTGGAAAAAAGGCTAA

Curator Acknowledgements
Curator Description Most Recent Edit