dfrA5

Download Sequences

Accession	ARO:3002861
CARD Short Name	dfrA5
Definition	dfrA5 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Family	trimethoprim resistant dihydrofolate reductase dfr
Drug Class	diaminopyrimidine antibiotic
Resistance Mechanism	antibiotic target replacement
Resistomes with Perfect Matches	Acinetobacter baumannii^wgs, Aeromonas caviae^p+wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Comamonas testosteroni^gi, Enterobacter hormaechei^g+wgs, Enterobacter kobei^p, Enterobacter roggenkampii^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Proteus mirabilis^wgs, Proteus vulgaris^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas putida^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p, Shigella boydii^wgs, Shigella flexneri^p+wgs, Shigella sonnei^wgs
Resistomes with Sequence Variants	Acinetobacter baumannii^wgs, Aeromonas caviae^p+wgs, Citrobacter freundii^wgs, Citrobacter koseri^wgs, Citrobacter portucalensis^p, Comamonas testosteroni^gi, Enterobacter hormaechei^g+wgs, Enterobacter kobei^p, Enterobacter roggenkampii^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^wgs, Klebsiella aerogenes^wgs, Klebsiella michiganensis^wgs, Klebsiella oxytoca^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^p+wgs, Proteus mirabilis^wgs, Proteus vulgaris^wgs, Pseudomonas aeruginosa^wgs, Pseudomonas putida^wgs, Salmonella enterica^g+p+wgs, Serratia marcescens^p, Shigella boydii^wgs, Shigella flexneri^p+wgs, Shigella sonnei^wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic target replacement [Resistance Mechanism] + antibiotic target replacement protein + diaminopyrimidine antibiotic [Drug Class] + antibiotic resistant dihydrofolate reductase + trimethoprim [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic trimethoprim [Antibiotic] + derives_from antibiotic sensitive dihydrofolate reductase + trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications	Thungapathra M, et al. 2002. Antimicrob Agents Chemother 46(9): 2948-2955. Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. (PMID 12183252)

Resistomes

Prevalence of dfrA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Acinetobacter baumannii	0%	0%	0.04%	0%
Acinetobacter baumannii	0%	0%	0.04%	0%
Aeromonas caviae	0%	1.3%	0.54%	0%
Aeromonas caviae	0%	1.3%	0.54%	0%
Citrobacter freundii	0%	0%	0.19%	0%
Citrobacter freundii	0%	0%	0.19%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter koseri	0%	0%	0.9%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Citrobacter portucalensis	0%	1.47%	0%	0%
Comamonas testosteroni	0%	0%	0%	100%
Comamonas testosteroni	0%	0%	0%	100%
Enterobacter hormaechei	0.36%	0%	0.99%	0%
Enterobacter hormaechei	0.36%	0%	0.99%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Enterobacter kobei	0%	0.69%	0%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%
Enterobacter roggenkampii	0%	0%	0.72%	0%
Escherichia albertii	0%	0%	1.29%	0%
Escherichia albertii	0%	0%	1.29%	0%
Escherichia coli	0.17%	0.26%	1.76%	0.13%
Escherichia coli	0.17%	0.25%	1.74%	0.13%
Escherichia fergusonii	0%	0%	2.17%	0%
Escherichia fergusonii	0%	0%	2.17%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%
Klebsiella aerogenes	0%	0%	0.28%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%
Klebsiella oxytoca	0%	0%	0.42%	0%
Klebsiella pneumoniae	0%	0.32%	0.89%	0%
Klebsiella pneumoniae	0%	0.32%	0.87%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%
Klebsiella quasipneumoniae	0%	0.21%	0.26%	0%
Proteus mirabilis	0%	0%	0.33%	0%
Proteus mirabilis	0%	0%	0.5%	0%
Proteus vulgaris	0%	0%	5.56%	0%
Proteus vulgaris	0%	0%	5.56%	0%
Pseudomonas aeruginosa	0%	0%	0.36%	0%
Pseudomonas aeruginosa	0%	0%	0.34%	0%
Pseudomonas putida	0%	0%	1.07%	0%
Pseudomonas putida	0%	0%	1.07%	0%
Salmonella enterica	0.13%	0.05%	0.29%	0%
Salmonella enterica	0.13%	0.05%	0.29%	0%
Serratia marcescens	0%	1.29%	0%	0%
Serratia marcescens	0%	1.29%	0%	0%
Shigella boydii	0%	0%	2.22%	0%
Shigella boydii	0%	0%	2.22%	0%
Shigella flexneri	0%	0.8%	0.31%	0%
Shigella flexneri	0%	0.8%	0.31%	0%
Shigella sonnei	0%	0%	1.31%	0%
Shigella sonnei	0%	0%	1.31%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|ABB89122.1|+|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKVSLMAAKAKNGVIGCGPHIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSAWTADNDNVIVFPSIEEAMYGLAEL
TDHVIVSGGGEIYRETLPMASTLHISTIDIEPEGDVFFPNIPNTFEVVFEQHFSSNINYCYQIWQKG

>gb|DQ278190.1|+|1-474|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
GTGAAAGTATCATTAATGGCTGCAAAAGCGAAAAACGGAGTGATTGGTTGCGGTCCACACATACCCTGGTCCGCGAAAGGAGAGCAGCTA
CTCTTTAAAGCCTTGACGTACAACCAGTGGCTTTTGGTGGGCCGCAAGACGTTCGAATCTATGGGAGCACTCCCTAATAGGAAATACGCG
GTCGTTACTCGCTCAGCCTGGACGGCCGATAATGACAACGTAATAGTATTCCCGTCGATCGAAGAGGCCATGTACGGGCTGGCTGAACTC
ACCGATCACGTTATAGTGTCTGGTGGCGGGGAGATTTACAGAGAAACATTGCCCATGGCCTCTACGCTCCATATATCGACGATTGATATT
GAGCCGGAAGGAGATGTTTTCTTTCCGAATATTCCCAATACCTTCGAAGTTGTTTTTGAGCAACACTTTAGCTCAAACATTAACTATTGC
TATCAAATTTGGCAAAAGGGTTAA

dfrA5

Prevalence: protein homolog model (view sequences)

Graph