dfrA5

Accession ARO:3002861
CARD Short NamedfrA5
DefinitiondfrA5 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Comamonas testosteronigi, Enterobacter hormaecheiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Proteus vulgariswgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaewgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Comamonas testosteronigi, Enterobacter hormaecheiwgs, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Proteus vulgariswgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Serratia marcescensp, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Thungapathra M, et al. 2002. Antimicrob Agents Chemother 46(9): 2948-2955. Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. (PMID 12183252)

Resistomes

Prevalence of dfrA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0%0.06%0%
Aeromonas caviae0%0%0.9%0%
Citrobacter freundii0%0%0.25%0%
Citrobacter koseri0%0%1.11%0%
Comamonas testosteroni0%0%0%100%
Enterobacter hormaechei0%0%1.3%0%
Enterobacter roggenkampii0%0%1.21%0%
Escherichia albertii0%0%1.15%0%
Escherichia coli0.11%0.25%1.97%0.13%
Escherichia fergusonii0%0%3.08%0%
Klebsiella aerogenes0%0%0.31%0%
Klebsiella michiganensis0%0%0.32%0%
Klebsiella pneumoniae0%0.23%1.04%0%
Klebsiella quasipneumoniae0%0.54%0.18%0%
Proteus mirabilis0%0%0.69%0%
Proteus vulgaris0%0%6.67%0%
Pseudomonas aeruginosa0%0%0.39%0%
Salmonella enterica0.15%0.07%0.3%0%
Serratia marcescens0%1.42%0%0%
Shigella boydii0%0%2.15%0%
Shigella flexneri0%0%0.33%0%
Shigella sonnei0%0%1.33%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|ABB89122.1|+|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKVSLMAAKAKNGVIGCGPHIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSAWTADNDNVIVFPSIEEAMYGLAEL
TDHVIVSGGGEIYRETLPMASTLHISTIDIEPEGDVFFPNIPNTFEVVFEQHFSSNINYCYQIWQKG


>gb|DQ278190.1|+|1-474|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
GTGAAAGTATCATTAATGGCTGCAAAAGCGAAAAACGGAGTGATTGGTTGCGGTCCACACATACCCTGGTCCGCGAAAGGAGAGCAGCTA
CTCTTTAAAGCCTTGACGTACAACCAGTGGCTTTTGGTGGGCCGCAAGACGTTCGAATCTATGGGAGCACTCCCTAATAGGAAATACGCG
GTCGTTACTCGCTCAGCCTGGACGGCCGATAATGACAACGTAATAGTATTCCCGTCGATCGAAGAGGCCATGTACGGGCTGGCTGAACTC
ACCGATCACGTTATAGTGTCTGGTGGCGGGGAGATTTACAGAGAAACATTGCCCATGGCCTCTACGCTCCATATATCGACGATTGATATT
GAGCCGGAAGGAGATGTTTTCTTTCCGAATATTCCCAATACCTTCGAAGTTGTTTTTGAGCAACACTTTAGCTCAAACATTAACTATTGC
TATCAAATTTGGCAAAAGGGTTAA