dfrA5

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002861
CARD Short NamedfrA5
DefinitiondfrA5 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (5), Klebsiella pneumoniae (2)
GAZ
FOODON
ENVO
UBERON
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniiwgs, Aeromonas caviaep+wgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Comamonas testosteronigi, Enterobacter hormaecheig+wgs, Enterobacter kobeip, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Proteus vulgariswgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs, Serratia marcescensp, Shigella boydiiwgs, Shigella flexnerip+wgs, Shigella sonneiwgs
Resistomes with Sequence VariantsAcinetobacter baumanniiwgs, Aeromonas caviaep+wgs, Citrobacter freundiiwgs, Citrobacter koseriwgs, Citrobacter portucalensisp, Comamonas testosteronigi, Enterobacter hormaecheig+wgs, Enterobacter kobeip, Enterobacter roggenkampiiwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs+gi, Escherichia fergusoniiwgs, Klebsiella aerogeneswgs, Klebsiella michiganensiswgs, Klebsiella oxytocawgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Proteus mirabiliswgs, Proteus vulgariswgs, Pseudomonas aeruginosawgs, Pseudomonas putidawgs, Salmonella entericag+p+wgs, Serratia marcescensp, Shigella boydiiwgs, Shigella flexnerip+wgs, Shigella sonneiwgs
Publications

Thungapathra M, et al. 2002. Antimicrob Agents Chemother 46(9): 2948-2955. Occurrence of antibiotic resistance gene cassettes aac(6')-Ib, dfrA5, dfrA12, and ereA2 in class I integrons in non-O1, non-O139 Vibrio cholerae strains in India. (PMID 12183252)

Resistomes

Prevalence of dfrA5 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0%0.04%0%0%
Aeromonas caviae0%1.3%0.54%0%0%
Citrobacter freundii0%0%0.19%0%0%
Citrobacter koseri0%0%0.9%0%0%
Citrobacter portucalensis0%1.47%0%0%0%
Comamonas testosteroni0%0%0%100%0%
Enterobacter hormaechei0.36%0%0.99%0%0%
Enterobacter kobei0%0.69%0%0%0%
Enterobacter roggenkampii0%0%0.72%0%0%
Escherichia albertii0%0%1.29%0%0%
Escherichia coli0.17%0.26%2.22%0.13%0.27%
Escherichia fergusonii0%0%2.17%0%0%
Klebsiella aerogenes0%0%0.56%0%0%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella oxytoca0%0%0.42%0%0%
Klebsiella pneumoniae0%0.32%1.34%0%0%
Klebsiella quasipneumoniae0%0.21%0.26%0%0%
Proteus mirabilis0%0%0.83%0%0%
Proteus vulgaris0%0%5.56%0%0%
Pseudomonas aeruginosa0%0%0.41%0%0%
Pseudomonas putida0%0%1.07%0%0%
Salmonella enterica0.13%0.05%0.34%0%0%
Serratia marcescens0%1.29%0%0%0%
Shigella boydii0%0%2.22%0%0%
Shigella flexneri0%0.8%0.31%0%0%
Shigella sonnei0%0%1.46%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ABB89122.1|+|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKVSLMAAKAKNGVIGCGPHIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSAWTADNDNVIVFPSIEEAMYGLAEL
TDHVIVSGGGEIYRETLPMASTLHISTIDIEPEGDVFFPNIPNTFEVVFEQHFSSNINYCYQIWQKG


>gb|DQ278190.1|+|1-474|dfrA5 [Salmonella enterica subsp. enterica serovar Enteritidis]
GTGAAAGTATCATTAATGGCTGCAAAAGCGAAAAACGGAGTGATTGGTTGCGGTCCACACATACCCTGGTCCGCGAAAGGAGAGCAGCTA
CTCTTTAAAGCCTTGACGTACAACCAGTGGCTTTTGGTGGGCCGCAAGACGTTCGAATCTATGGGAGCACTCCCTAATAGGAAATACGCG
GTCGTTACTCGCTCAGCCTGGACGGCCGATAATGACAACGTAATAGTATTCCCGTCGATCGAAGAGGCCATGTACGGGCTGGCTGAACTC
ACCGATCACGTTATAGTGTCTGGTGGCGGGGAGATTTACAGAGAAACATTGCCCATGGCCTCTACGCTCCATATATCGACGATTGATATT
GAGCCGGAAGGAGATGTTTTCTTTCCGAATATTCCCAATACCTTCGAAGTTGTTTTTGAGCAACACTTTAGCTCAAACATTAACTATTGC
TATCAAATTTGGCAAAAGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit