dfrA7

Accession ARO:3002862
CARD Short NamedfrA7
DefinitiondfrA7 is an integron-encoded dihydrofolate reductase found in Escherichia coli.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAcinetobacter baumanniip+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Cronobacter sakazakiip, Enterobacter cloacaewgs, Escherichia colig+p+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Pseudomonas aeruginosawgs, Salmonella entericag+p+wgs, Shigella boydiiwgs, Shigella flexneriwgs, Shigella sonneiwgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
Publications

Ozgumus OB, et al. 2009. J Microbiol 47(1): 19-27. Class 1 and class 2 integrons and plasmid-mediated antibiotic resistance in coliforms isolated from ten rivers in northern Turkey. (PMID 19229487)

Resistomes

Prevalence of dfrA7 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii0%0.42%0.3%0%
Citrobacter freundii0%0%0.19%0%
Citrobacter werkmanii0%0%5.13%0%
Cronobacter sakazakii0%2.56%0%0%
Enterobacter cloacae0%0%0.32%0%
Escherichia coli0.55%0.03%1.03%0%
Klebsiella pneumoniae0.12%0.02%0.32%0%
Morganella morganii0%0%0.61%0%
Pseudomonas aeruginosa0%0%0.01%0%
Salmonella enterica1.51%1.2%1.27%0%
Shigella boydii0%0%4.44%0%
Shigella flexneri0%0%0.78%0%
Shigella sonnei0%0%0.22%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|ACS44716.1|+|dfrA7 [Acinetobacter baumannii]
MKISLISATSENGVIGNGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFDSMGVLPNRKYAVVSRKGISSSNENVLVFPSIEIALQELSKI
TDHLYVSGGGQIYNSLIEKADIIHLSTVHVEVEGDINFPKIPENFNLVFEQFFLSNINYTYQIWKKG


>gb|FJ854362.1|+|2339-2812|dfrA7 [Acinetobacter baumannii]
TTGAAAATTTCATTGATTTCTGCAACGTCAGAAAATGGCGTAATCGGTAATGGCCCTGATATCCCATGGTCAGCAAAAGGTGAGCAGTTA
CTCTTTAAAGCGCTCACATATAATCAGTGGCTCCTTGTTGGAAGGAAAACATTTGACTCTATGGGTGTTCTTCCAAATCGAAAATATGCA
GTAGTGTCGAGGAAAGGAATTTCAAGCTCAAATGAAAATGTATTAGTCTTTCCTTCAATAGAAATCGCTTTGCAAGAACTATCGAAAATT
ACAGATCATTTATATGTCTCTGGTGGCGGTCAAATCTACAATAGTCTTATTGAAAAAGCAGATATAATTCATTTGTCTACTGTTCACGTT
GAGGTTGAAGGTGATATCAATTTTCCTAAAATTCCAGAGAATTTCAATTTGGTTTTTGAGCAGTTTTTTTTGTCTAATATAAATTACACA
TATCAGATTTGGAAAAAAGGCTAA