dfrA8

Download Sequences

Accession	ARO:3002863
Synonym(s)	dhfrIIIc
CARD Short Name	dfrA8
Definition	dfrA8 is a transposon-encoded dihydrofolate reductase found in Salmonella enterica.
AMR Gene Family	trimethoprim resistant dihydrofolate reductase dfr
Drug Class	diaminopyrimidine antibiotic
Resistance Mechanism	antibiotic target replacement
Resistomes with Perfect Matches	Citrobacter amalonaticus^wgs, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Shigella flexneri^wgs, Shigella sonnei^wgs, Vibrio cholerae^wgs
Resistomes with Sequence Variants	Citrobacter amalonaticus^wgs, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^wgs, Escherichia albertii^wgs, Escherichia coli^g+p+wgs+gi, Klebsiella pneumoniae^p+wgs, Providencia rettgeri^wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^wgs, Serratia marcescens^wgs, Shigella flexneri^wgs, Shigella sonnei^wgs, Vibrio cholerae^wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic target replacement [Resistance Mechanism] + antibiotic target replacement protein + diaminopyrimidine antibiotic [Drug Class] + antibiotic resistant dihydrofolate reductase + trimethoprim [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic trimethoprim [Antibiotic] + derives_from antibiotic sensitive dihydrofolate reductase + trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications	Rodrigues GL, et al. 2020. Front Microbiol 11:1864 Frequency of Antimicrobial Resistance Genes in Salmonella From Brazil by in silico Whole-Genome Sequencing Analysis: An Overview of the Last Four Decades. (PMID 32849452)

Resistomes

Prevalence of dfrA8 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Enterobacter asburiae	0%	0.28%	0%	0%	0%
Enterobacter asburiae	0%	0.28%	0%	0%	0%
Enterobacter cloacae	0%	0.56%	0%	0%	0%
Enterobacter cloacae	0%	0.56%	0%	0%	0%
Enterobacter hormaechei	0%	0%	0.26%	0%	0%
Enterobacter hormaechei	0%	0%	0.26%	0%	0%
Escherichia albertii	0%	0%	1.29%	0%	0%
Escherichia albertii	0%	0%	1.29%	0%	0%
Escherichia coli	0.17%	0.1%	1.34%	0.13%	0%
Escherichia coli	0.17%	0.1%	1.34%	0.13%	0%
Klebsiella pneumoniae	0%	0.03%	0.2%	0%	0%
Klebsiella pneumoniae	0%	0.03%	0.2%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Providencia rettgeri	0%	0%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0%	0.21%	0%	0%
Salmonella enterica	0%	0%	0.21%	0%	0%
Serratia marcescens	0%	0%	1.97%	0%	0%
Serratia marcescens	0%	0%	1.97%	0%	0%
Shigella flexneri	0%	0%	0.62%	0%	0%
Shigella flexneri	0%	0%	0.47%	0%	0%
Shigella sonnei	0%	0%	2.78%	0%	0%
Shigella sonnei	0%	0%	2.78%	0%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%
Vibrio cholerae	0%	0%	0.06%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|AHV80711.1|+|dfrA8 [Salmonella enterica subsp. enterica serovar Typhimurium]
MIELHAILAATANGCIGKDNALPWPPLKGDLARFKKLTMGKVVIMGRKTYESLPVKLEGRTCIVMTRQALELPGVRDANGAIFVNNVSDA
MRFAQEESVGDVAYVIGGAEIFKRLALMITQIELTFVKRLYEGDTYVDLAEMVKDYEQNGMEEHDLHTYFTYRKKELTE

>gb|KJ174469.1|+|711-1220|dfrA8 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGATCGAGCTTCATGCCATTTTAGCTGCCACCGCCAATGGTTGCATTGGGAAGGACAACGCACTTCCCTGGCCACCACTAAAAGGCGAT
CTGGCCAGATTCAAAAAATTGACCATGGGGAAGGTGGTCATTATGGGGCGCAAGACCTATGAGAGCTTGCCCGTCAAATTAGAAGGTCGC
ACCTGCATCGTTATGACGCGCCAAGCGCTGGAGCTTCCGGGTGTTCGTGACGCTAACGGCGCTATCTTCGTGAACAACGTCAGCGACGCC
ATGCGGTTCGCTCAAGAAGAGAGCGTGGGCGATGTGGCCTACGTCATTGGTGGCGCTGAGATATTCAAGCGACTTGCCTTGATGATCACG
CAGATTGAATTGACCTTTGTTAAGCGACTGTACGAAGGCGACACCTACGTTGATCTGGCCGAAATGGTCAAAGACTACGAGCAGAATGGC
ATGGAAGAACATGACCTTCACACTTACTTCACTTACCGTAAAAAGGAGCTTACAGAATGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

dfrA8

Prevalence: protein homolog model (view sequences)

Graph