dfrC

Accession ARO:3002865
DefinitiondfrC is a chromosome-encoded dihydrofolate reductase found in Staphylococcus aureus
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
ResistomesStaphylococcus epidermidisg+wgs
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Dale GE, et al. 1995. J Bacteriol 177(11): 2965-2970. Characterization of the gene for the chromosomal dihydrofolate reductase (DHFR) of Staphylococcus epidermidis ATCC 14990: the origin of the trimethoprim-resistant S1 DHFR from Staphylococcus aureus?. (PMID 7768789)

Resistomes

Prevalence of dfrC among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Enterococcus faecalis0%0%5.43%
Listeria monocytogenes0%0%0.04%
Serratia marcescens0%0%0.23%
Staphylococcus aureus2.37%0.64%5.36%
Staphylococcus epidermidis95.45%0%98.53%
Staphylococcus pseudintermedius0%0%0.51%
Streptococcus pneumoniae0%0%0.01%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AAO04716.1|-|dfrC [Staphylococcus epidermidis ATCC 12228]
MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRNVVLTNQASFHHEGVDVINSLDEIKELSGHV
FIFGGQTLFEAMIDQVDDMYITVIDGKFQGDTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK


>gb|AE015929.1|-|1128934-1129419|dfrC [Staphylococcus epidermidis ATCC 12228]
ATGACATTATCAATAATTGTCGCTCACGATAAACAAAGAGTCATTGGGTACCAAAATCAATTACCTTGGCACTTACCAAATGATTTAAAG
CATGTTAAACAACTGACCACTGGGAATACACTTGTAATGGGACGGAAAACTTTTAATTCTATAGGGAAACCATTGCCAAATAGACGTAAC
GTCGTACTCACTAACCAAGCTTCATTTCACCATGAAGGGGTAGATGTTATAAACTCTCTTGATGAAATTAAAGAGTTATCTGGTCATGTT
TTTATATTTGGAGGACAAACGTTATTCGAGGCAATGATTGACCAGGTAGATGATATGTATATCACAGTAATAGATGGAAAGTTTCAAGGA
GACACATTCTTTCCACCATACACATTCGAAAACTGGGAAGTCGAATCTTCAGTAGAAGGTCAACTAGATGAAAAAAATACTATACCGCAT
ACATTCTTACATTTAGTGCGTAGAAAAGGGAAATAG