dfrF

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002867
CARD Short NamedfrF
DefinitiondfrF is a chromosome-encoded dihydrofolate reductase found in Streptococcus pyogenes.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAnaerostipes hadruswgs, Bifidobacterium brevewgs, Bifidobacterium longumwgs, Enterocloster clostridioformiswgs, Enterococcus faecalisg+wgs, Enterococcus faeciumwgs, Erysipelatoclostridium ramosumwgs, Staphylococcus aureuswgs, Streptococcus agalactiaewgs, Streptococcus anginosusg+wgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianuswgs, Streptococcus pyogenesg+wgs+gi, Streptococcus suiswgs
Resistomes with Sequence VariantsAnaerostipes hadruswgs, Bifidobacterium brevewgs, Bifidobacterium longumwgs, Enterocloster clostridioformiswgs, Enterococcus faecalisg+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Erysipelatoclostridium ramosumwgs, Staphylococcus aureuswgs, Streptococcus agalactiaewgs, Streptococcus anginosusg+wgs, Streptococcus dysgalactiaeg, Streptococcus equiwgs, Streptococcus gallolyticuswgs, Streptococcus lutetiensiswgs, Streptococcus pasteurianusg+wgs+gi, Streptococcus pyogenesg+wgs+gi, Streptococcus suiswgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Bergmann R, et al. 2014. Antimicrob Agents Chemother 58(4): 2281-2288. Factors that cause trimethoprim resistance in Streptococcus pyogenes. (PMID 24492367)

Resistomes

Prevalence of dfrF among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Anaerostipes hadrus0%0%8.62%0%0%
Bifidobacterium breve0%0%3.61%0%0%
Bifidobacterium longum0%0%2.97%0%0%
Enterocloster clostridioformis0%0%4.65%0%0%
Enterococcus faecalis3.64%0%3.78%4.17%0%
Enterococcus faecium34.08%0.06%25.79%3.92%0%
Erysipelatoclostridium ramosum0%0%53.49%0%0%
Escherichia coli0%0%0%0%0%
Staphylococcus aureus0%0%0.06%0%0%
Streptococcus agalactiae0%0%0.13%0%0%
Streptococcus anginosus11.76%0%13.45%0%0%
Streptococcus dysgalactiae2%0%0%0%0%
Streptococcus equi0%0%0.23%0%0%
Streptococcus gallolyticus0%0%2.27%0%0%
Streptococcus lutetiensis0%0%34.69%0%0%
Streptococcus pasteurianus25%0%45%16.67%0%
Streptococcus pyogenes0.37%0%0.31%9.09%0%
Streptococcus suis0%0%0.79%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAD01868.1|+|dfrF [Enterococcus faecalis]
MIGLIVARSKNNVIGKNGNIPWKIKGEQKQFRELTTGNVVIMGRKSYEEIGHPLPNRMNIVVSTTTEYQGDNLVSVKSLEDALLLAKGRD
VYISGGYGLFKEALQIVDKMYITEVDLNIEDGDTFFPEFDINDFEVLIGETLGEEVKYTRTFYVRKNELSRFWI


>gb|AF028812.1|+|393-887|dfrF [Enterococcus faecalis]
ATGATAGGTTTGATTGTTGCGAGGTCAAAGAATAATGTTATAGGCAAGAATGGTAATATACCATGGAAAATAAAGGGAGAACAAAAGCAA
TTTAGAGAGTTAACAACGGGTAATGTGGTTATTATGGGGCGAAAGTCTTATGAAGAAATCGGTCATCCGTTGCCTAATAGAATGAATATT
GTTGTTTCCACCACAACAGAGTATCAAGGAGATAATTTAGTTTCAGTTAAATCATTAGAAGATGCATTATTATTGGCTAAAGGACGAGAT
GTATACATATCTGGTGGATATGGACTATTTAAGGAAGCTTTGCAAATAGTAGATAAAATGTATATCACAGAAGTAGATTTAAATATTGAA
GATGGAGATACATTCTTTCCAGAATTTGATATCAATGATTTTGAAGTTTTGATAGGGGAAACACTTGGTGAGGAAGTGAAATATACGAGA
ACATTTTATGTAAGGAAAAATGAATTGAGTAGATTTTGGATTTAG

Curator Acknowledgements
Curator Description Most Recent Edit