dfrG

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002868
CARD Short NamedfrG
DefinitiondfrG is a plasmid-encoded dihydrofolate reductase found in Staphylococcus aureus.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONStaphylococcus aureus (8)
GAZ
FOODON
ENVO
UBERON
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesEnterococcus aviumwgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraep+wgs, Escherichia coliwgs, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Lactococcus garvieaep, Ligilactobacillus animaliswgs, Listeria innocuag+p, Listeria monocytogenesg+wgs, Staphylococcus arlettaeg+wgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidisg+p+wgs, Staphylococcus equorumg, Staphylococcus haemolyticusg+wgs+gi, Staphylococcus hominiswgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticusg+wgs+gi, Staphylococcus warnerig+wgs, Streptococcus agalactiaewgs, Streptococcus pyogenesg+wgs, Streptococcus suisg+wgs
Resistomes with Sequence VariantsEnterococcus aviumwgs, Enterococcus faecalisg+p+wgs+gi, Enterococcus faeciumg+p+wgs+gi, Enterococcus hiraep+wgs, Escherichia coliwgs, Jeotgalibaca arthritidisgi, Jeotgalibaca porcigi, Klebsiella aerogeneswgs, Klebsiella pneumoniaewgs, Lactococcus garvieaep, Ligilactobacillus animaliswgs, Listeria innocuag+p, Listeria monocytogenesg+wgs, Staphylococcus arlettaeg+wgs, Staphylococcus aureusg+p+wgs+gi, Staphylococcus epidermidisg+p+wgs, Staphylococcus equorumg, Staphylococcus haemolyticusg+wgs+gi, Staphylococcus hominiswgs, Staphylococcus pasteuriwgs, Staphylococcus pseudintermediusg+wgs+gi, Staphylococcus saprophyticusg+wgs+gi, Staphylococcus warnerig+wgs, Streptococcus agalactiaewgs, Streptococcus pyogenesg+wgs, Streptococcus suisg+wgs
Publications

Sekiguchi J, et al. 2005. Antimicrob Agents Chemother 49(9): 3948-3951. Cloning and characterization of a novel trimethoprim-resistant dihydrofolate reductase from a nosocomial isolate of Staphylococcus aureus CM.S2 (IMCJ1454). (PMID 16127079)

Resistomes

Prevalence of dfrG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Enterococcus avium0%0%12.28%0%0%
Enterococcus faecalis10.45%9.11%16.37%8.33%0%
Enterococcus faecium24.84%2.01%32.81%15.69%0%
Enterococcus hirae0%4.76%4.17%0%0%
Escherichia coli0%0%0.01%0%0%
Jeotgalibaca arthritidis0%0%0%33.33%0%
Jeotgalibaca porci0%0%0%50%0%
Klebsiella aerogenes0%0%0.28%0%0%
Klebsiella pneumoniae0%0%0.02%0%0%
Lactococcus garvieae0%4.17%0%0%0%
Ligilactobacillus animalis0%0%8.33%0%0%
Listeria innocua5.88%10.53%0%0%0%
Listeria monocytogenes0.28%0%0.09%0%0%
Staphylococcus arlettae16.67%0%7.5%0%0%
Staphylococcus aureus9.86%0.3%7.39%6.3%0%
Staphylococcus epidermidis3.87%0.29%7.2%0%0%
Staphylococcus equorum8.33%0%0%0%0%
Staphylococcus haemolyticus44.83%0%18.46%13.33%0%
Staphylococcus hominis0%0%0.98%0%0%
Staphylococcus pasteuri0%0%3.85%0%0%
Staphylococcus pseudintermedius36.67%0%52.05%6.67%0%
Staphylococcus saprophyticus11.76%0%6.99%100%0%
Staphylococcus warneri8.33%0%7.38%0%0%
Streptococcus agalactiae0%0%0.06%0%0%
Streptococcus pyogenes2.61%0%0.05%0%0%
Streptococcus suis0.8%0%1.57%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|BAE15963.1|+|dfrG [Staphylococcus aureus]
MKVSLIAAMDKNRVIGKENDIPWRIPKDWEYVKNTTKGHPIILGRKNLESIGRALPDRRNIILTRDKGFTFNGCEIVHSIEDVFELCKNE
EEIFIFGGEQIYNLFFPYVEKMYITKIHHEFEGDTFFPEVNYEEWNEVFAQKGIKNDKNPYNYYFHVYERKNLLS


>gb|AB205645.1|+|1013-1510|dfrG [Staphylococcus aureus]
ATGAAAGTTTCTTTGATTGCTGCGATGGATAAGAATAGAGTGATTGGCAAAGAGAATGACATTCCTTGGAGGATTCCCAAGGACTGGGAA
TATGTTAAAAATACTACAAAGGGACATCCGATAATATTAGGTAGGAAGAACCTTGAATCAATCGGAAGAGCCTTACCTGACAGAAGAAAT
ATTATTCTGACGAGAGATAAGGGGTTTACCTTTAATGGTTGTGAAATTGTTCATTCAATAGAAGATGTTTTTGAGTTATGTAAAAACGAA
GAAGAAATTTTTATTTTCGGAGGAGAACAGATTTATAATTTGTTTTTCCCTTATGTTGAGAAAATGTACATCACAAAAATACATCATGAA
TTCGAAGGAGATACTTTTTTTCCAGAAGTGAATTATGAGGAATGGAATGAGGTATTTGCCCAAAAAGGGATAAAGAATGATAAAAATCCG
TATAACTACTATTTTCATGTATATGAAAGAAAAAACTTATTGAGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit