vanY gene in vanG cluster

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3002959
Synonym(s)vanY-G vanYG vanYG1
CARD Short NamevanY_in_vanG_cl
DefinitionAlso known as vanYG, is a vanY variant found in the vanG gene cluster.
AMR Gene Familyglycopeptide resistance gene cluster, vanY
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
Classification14 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ vanY [AMR Gene Family]
+ part_of glycopeptide resistance gene cluster VanG
Resistomes with Perfect MatchesStreptococcus agalactiaeg, Streptococcus anginosusg
Resistomes with Sequence VariantsAnaerococcus mediterraneensisg, Bacillus cereuswgs, Bacillus halotoleransg+wgs, Bacillus pumilusg+wgs, Bacillus subtilisg+wgs, Bacillus tequilensiswgs, Bacillus thuringiensisg+p+wgs, Brevibacillus laterosporusg+wgs, Clostridium botulinumg+wgs, Clostridium perfringensg+wgs, Clostridium sporogeneswgs, Enterocloster clostridioformiswgs, Erysipelothrix rhusiopathiaeg, Gemella haemolysanswgs, Jeotgalibaca arthritidisg, Jeotgalibaca ciconiaeg, Lactococcus garvieaewgs, Listeria innocuag+wgs, Listeria monocytogeneswgs, Moraxella catarrhalisg+wgs, Paenibacillus mucilaginosusg+wgs, Parvimonas micrag+wgs, Ruthenibacterium lactatiformansg+wgs, Staphylococcus haemolyticuswgs, Staphylococcus hominisg+wgs, Streptococcus agalactiaeg, Streptococcus anginosusg, Streptococcus cristatusg+wgs, Streptococcus gordoniig+wgs, Streptococcus intermediusg+wgs, Streptococcus mutansg+wgs, Streptococcus sanguinisg+wgs, Streptococcus sobrinuswgs, Streptococcus suiswgs, Thomasclavelia ramosawgs, Vibrio parahaemolyticuswgs
Publications

Boyd DA, et al. 2006. Antimicrob Agents Chemother 50(6): 2217-2221. VanG-type vancomycin-resistant Enterococcus faecalis strains isolated in Canada. (PMID 16723588)

Resistomes

Prevalence of vanY gene in vanG cluster among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Anaerococcus mediterraneensis100%0%0%0%0%
Bacillus cereus0%0%0.4%0%0%
Bacillus halotolerans90.91%0%97.3%0%0%
Bacillus pumilus100%0%100%0%0%
Bacillus subtilis31.54%0%32.08%0%0%
Bacillus tequilensis0%0%33.33%0%0%
Bacillus thuringiensis1.25%0.59%2.44%0%0%
Brevibacillus laterosporus50%0%26.47%0%0%
Clostridium botulinum28.36%0%16.58%0%0%
Clostridium perfringens2.5%0%3.67%0%0%
Clostridium sporogenes0%0%2.56%0%0%
Enterocloster clostridioformis0%0%4.65%0%0%
Erysipelothrix rhusiopathiae9.09%0%0%0%0%
Gemella haemolysans0%0%12.5%0%0%
Jeotgalibaca arthritidis100%0%0%0%0%
Jeotgalibaca ciconiae100%0%0%0%0%
Lactococcus garvieae0%0%8.89%0%0%
Listeria innocua5.88%0%2.26%0%0%
Listeria monocytogenes0%0%0.02%0%0%
Moraxella catarrhalis87.5%0%75.65%0%0%
Paenibacillus mucilaginosus100%0%100%0%0%
Parvimonas micra40%0%18.75%0%0%
Ruthenibacterium lactatiformans100%0%100%0%0%
Staphylococcus haemolyticus0%0%0.22%0%0%
Staphylococcus hominis93.75%0%92.68%0%0%
Streptococcus agalactiae1.87%0%0%0%0%
Streptococcus anginosus5.88%0%0%0%0%
Streptococcus cristatus100%0%94.29%0%0%
Streptococcus gordonii92.86%0%91.03%0%0%
Streptococcus intermedius57.14%0%38.64%0%0%
Streptococcus mutans100%0%100%0%0%
Streptococcus sanguinis100%0%87.63%0%0%
Streptococcus sobrinus0%0%10.2%0%0%
Streptococcus suis0%0%0.42%0%0%
Thomasclavelia ramosa0%0%8.14%0%0%
Vibrio parahaemolyticus0%0%0.21%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 50


>gb|ABA71729.1|+|vanY gene in vanG cluster [Enterococcus faecalis]
MNHMNMKHRRRKRRRNQSFLFTGILLLVVVSASSFLWYGFGNAAKKDSVIEEMPFTITQDGMQAKEEIKKTVLETSYGGKQQVAEENHGN
TQNAGTDEAWNLMLVNRDNAIPDNYEVNLVEVEGGERVDERIYEPLMEMLNAAREENWGELPMVVSGYRTQEKQQSLYDEKIAKFKKEGY
SDSEAVRQAEQWVAVPGHSEHQLGFAVDINGATYDVYLWLQENSYKYGFIFRYPGSKTDITGTAEEVWHYRYVGVEAATEMYENGLCLEE
YLEKKQSEN


>gb|DQ212986.1|+|4223-5062|vanY gene in vanG cluster [Enterococcus faecalis]
ATGAACCATATGAATATGAAACACAGACGCAGAAAACGCAGACGTAACCAATCTTTTTTGTTCACAGGAATTTTACTCTTAGTTGTAGTA
TCTGCAAGCAGTTTTTTATGGTACGGTTTTGGCAATGCGGCAAAAAAAGACAGTGTTATTGAAGAAATGCCATTTACCATTACACAGGAC
GGAATGCAGGCAAAGGAAGAAATAAAGAAAACGGTACTGGAAACTTCCTATGGCGGCAAACAGCAGGTAGCGGAAGAAAATCACGGCAAT
ACACAAAATGCAGGGACAGACGAAGCGTGGAATTTAATGCTTGTCAACAGAGATAATGCGATTCCAGACAATTACGAAGTAAATCTGGTC
GAAGTAGAGGGCGGGGAGCGTGTAGATGAGCGTATCTATGAACCTCTTATGGAAATGCTTAATGCGGCAAGGGAGGAAAACTGGGGCGAA
TTGCCGATGGTAGTATCTGGCTATCGGACGCAGGAAAAACAGCAGAGCCTTTATGATGAAAAGATTGCAAAGTTCAAAAAAGAGGGGTAT
TCAGACAGTGAAGCCGTAAGGCAGGCAGAACAATGGGTTGCAGTGCCAGGTCACAGTGAGCATCAGCTCGGTTTTGCAGTGGATATTAAC
GGGGCAACTTATGATGTTTATCTATGGTTGCAGGAAAACAGCTATAAATACGGCTTTATCTTCAGATATCCCGGCAGTAAAACGGATATT
ACCGGGACTGCTGAAGAAGTATGGCATTACCGTTATGTTGGAGTGGAAGCGGCAACTGAAATGTATGAAAATGGATTATGTCTTGAGGAA
TATCTTGAGAAAAAGCAATCAGAAAACTAA

Curator Acknowledgements
Curator Description Most Recent Edit