bmr

Accession ARO:3003007
Definitionbmr is an MFS antibiotic efflux pump that confers resistance to multiple drugs including acridine dyes, fluoroquinolone antibiotics, chloramphenicol, and puromycin
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classnucleoside antibiotic, tetracycline antibiotic, nitroimidazole antibiotic, phenicol antibiotic, fluoroquinolone antibiotic, penam, acridine dye, bicyclomycin, antibacterial free fatty acids, rhodamine, cephalosporin, diaminopyrimidine antibiotic, oxazolidinone antibiotic, fosfomycin, peptide antibiotic, lincosamide antibiotic, glycylcycline, macrolide antibiotic, benzalkonium chloride, isoniazid, rifamycin antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification31 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ confers_resistance_to_antibiotic puromycin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic chloramphenicol [Antibiotic]
Publications

Klyachko KA, et al. 1997. J Bacteriol 179(7): 2189-2193. Mutations affecting substrate specificity of the Bacillus subtilis multidrug transporter Bmr. (PMID 9079903)

Neyfakh AA, et al. 1991. Proc Natl Acad Sci U S A 88(11): 4781-4785. Efflux-mediated multidrug resistance in Bacillus subtilis: similarities and dissimilarities with the mammalian system. (PMID 1675788)

Resistomes

Prevalence of bmr among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 750


>gb|AAA22277.1|+|bmr [Bacillus subtilis]
MEKKNITLTILLTNLFIAFLGIGLVIPVTPTIMNELHLSGTAVGYMVACFAITQLIVSPIAGRWVDRFGRKIMIVIGLLFFSVSEFLFGI
GKTVEMLFISRMLGGISAPFIMPGVTAFIADITTIKTRPKALGYMSAAISTGFIIGPGIGGFLAEVHSRLPFFFAAAFALLAAILSILTL
REPERNPENQEIKGQKTGFKRIFAPMYFIAFLIILISSFGLASFESLFALFVDHKFGFTASDIAIMITGGAIVGAITQVVLFDRFTRWFG
EIHLIRYSLILSTSLVFLLTTVHSYVAILLVTVTVFVGFDLMRPAVTTYLSKIAGNEQGFAGGMNSMFTSIGNVFGPIIGGMLFDIDVNY
PFYFATVTLAIGIALTIAWKAPAHLKAST


>gb|M33768|+|195-1364|bmr [Bacillus subtilis]
ATGGAGAAGAAAAATATTACCTTAACTATATTATTAACCAATTTATTTATTGCTTTTTTGGGGATCGGGCTTGTGATTCCAGTAACGCCG
ACCATTATGAATGAATTGCATTTATCGGGGACCGCGGTCGGCTATATGGTTGCCTGCTTCGCTATTACACAGCTCATTGTCTCACCAATA
GCCGGACGATGGGTTGATCGCTTCGGGCGCAAGATCATGATCGTAATCGGCCTGTTGTTCTTTAGTGTGTCGGAGTTTTTGTTCGGCATT
GGAAAAACAGTTGAGATGTTATTTATCTCCCGTATGCTGGGCGGTATCAGCGCACCGTTCATTATGCCCGGGGTCACGGCTTTTATTGCA
GATATCACGACCATTAAAACACGGCCAAAAGCGCTCGGTTATATGTCAGCCGCTATTTCAACAGGATTTATTATCGGCCCCGGCATCGGG
GGATTTTTAGCAGAAGTCCATTCCCGGCTGCCTTTTTTCTTTGCGGCAGCTTTTGCACTGTTAGCAGCCATTTTATCAATCCTCACGCTG
CGCGAGCCGGAACGAAACCCTGAAAATCAGGAAATAAAAGGACAGAAGACAGGCTTTAAACGAATTTTTGCCCCCATGTATTTCATAGCT
TTTCTCATTATCTTAATTTCGTCTTTTGGTTTAGCATCATTTGAATCTTTATTTGCATTATTCGTGGATCATAAATTCGGATTTACGGCC
AGCGACATTGCCATTATGATTACAGGAGGAGCGATTGTTGGCGCCATTACGCAAGTCGTCTTATTCGACCGCTTCACAAGATGGTTTGGC
GAAATTCATTTAATTCGGTACAGCTTAATTCTCTCGACGAGTCTGGTATTCTTGCTGACAACGGTACATTCATATGTTGCGATTCTGCTG
GTGACAGTCACCGTATTTGTCGGATTTGATCTCATGCGGCCTGCGGTAACGACTTACCTGTCAAAGATTGCGGGAAATGAACAGGGGTTT
GCCGGCGGTATGAATTCAATGTTTACAAGTATCGGCAATGTATTCGGGCCTATTATCGGCGGAATGCTGTTCGATATAGATGTAAACTAT
CCTTTCTACTTTGCAACGGTCACCTTAGCCATAGGGATTGCACTGACCATTGCTTGGAAAGCGCCTGCACATCTTAAAGCCAGCACGTGA