dfrA15

Download Sequences

Ontology	CARD's Antibiotic Resistance Ontology
Accession	ARO:3003013
CARD Short Name	dfrA15
Definition	dfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Family	trimethoprim resistant dihydrofolate reductase dfr
Drug Class	diaminopyrimidine antibiotic
Resistance Mechanism	antibiotic target replacement
Resistomes with Perfect Matches	Aeromonas caviae^wgs, Aeromonas veronii^wgs, Alcaligenes faecalis^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Escherichia albertii^p, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Shigella sonnei^wgs, Vibrio alginolyticus^p, Vibrio cholerae^p+wgs
Resistomes with Sequence Variants	Aeromonas caviae^wgs, Aeromonas veronii^wgs, Alcaligenes faecalis^wgs, Citrobacter amalonaticus^wgs, Citrobacter freundii^wgs, Citrobacter werkmanii^wgs, Citrobacter youngae^wgs, Corynebacterium diphtheriae^wgs, Enterobacter asburiae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Escherichia albertii^p, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Proteus mirabilis^wgs, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Shewanella putrefaciens^g+p, Shigella sonnei^wgs, Vibrio alginolyticus^p, Vibrio cholerae^p+wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic molecule + antibiotic target replacement [Resistance Mechanism] + antibiotic target replacement protein + diaminopyrimidine antibiotic [Drug Class] + antibiotic resistant dihydrofolate reductase + trimethoprim [Antibiotic]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic trimethoprim [Antibiotic] + derives_from antibiotic sensitive dihydrofolate reductase + trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications	Ceccarelli D, et al. 2006. J Antimicrob Chemother 58(5): 1095-1097. Prevalence of aadA1 and dfrA15 class 1 integron cassettes and SXT circulation in Vibrio cholerae O1 isolates from Africa. (PMID 16980697)

Resistomes

Prevalence of dfrA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Aeromonas caviae	0%	0%	0.54%	0%	0%
Aeromonas caviae	0%	0%	0.54%	0%	0%
Aeromonas veronii	0%	0%	2.81%	0%	0%
Aeromonas veronii	0%	0%	2.81%	0%	0%
Alcaligenes faecalis	0%	0%	2.94%	0%	0%
Alcaligenes faecalis	0%	0%	2.94%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter amalonaticus	0%	0%	1.82%	0%	0%
Citrobacter freundii	0%	0%	0.39%	0%	0%
Citrobacter freundii	0%	0%	0.39%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Citrobacter youngae	0%	0%	6.25%	0%	0%
Corynebacterium diphtheriae	0%	0%	0.63%	0%	0%
Corynebacterium diphtheriae	0%	0%	0%	0%	0%
Enterobacter asburiae	0%	0%	0.4%	0%	0%
Enterobacter asburiae	0%	0%	0.4%	0%	0%
Enterobacter cloacae	0%	0%	2.56%	0%	0%
Enterobacter cloacae	0%	0%	2.56%	0%	0%
Enterobacter hormaechei	0%	1.03%	5.48%	0%	0%
Enterobacter hormaechei	0%	1.03%	5.31%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%	0%
Escherichia coli	0%	0.04%	0.27%	0%	2.66%
Escherichia coli	0%	0.04%	0.27%	0%	2.66%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella michiganensis	0%	0%	0.27%	0%	0%
Klebsiella pneumoniae	0%	0.03%	0.64%	0%	0%
Klebsiella pneumoniae	0%	0.03%	0.64%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.66%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.53%	0%	0%
Morganella morganii	0%	0%	1.84%	0%	0%
Morganella morganii	0%	0%	1.84%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Proteus mirabilis	0%	0%	0.17%	0%	0%
Providencia rettgeri	0%	2.7%	0.64%	0%	0%
Providencia rettgeri	0%	2.7%	0.64%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.03%	0%	0%
Pseudomonas aeruginosa	0%	0%	0.01%	0%	0%
Salmonella enterica	0%	0.16%	0.24%	0%	0%
Salmonella enterica	0%	0.16%	0.24%	0%	0%
Shewanella putrefaciens	11.11%	20%	0%	0%	0%
Shewanella putrefaciens	0%	0%	0%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%	0%
Vibrio alginolyticus	0%	3.57%	0%	0%	0%
Vibrio alginolyticus	0%	3.57%	0%	0%	0%
Vibrio cholerae	0%	5.26%	0.19%	0%	0%
Vibrio cholerae	0%	5.26%	0.19%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|AHB39758.1|+|dfrA15 [Escherichia coli]
MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTI
TDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEIPSSFRPVFSQDFVSNINYSYQIWQKG

>gb|KF534911.1|+|40-513|dfrA15 [Escherichia coli]
GTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTA
CTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCC
GTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATA
ACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGTTGATACTTTACATATTTCAACAATCGACATT
GAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCAGTAGTTTTAGGCCAGTTTTTAGCCAAGACTTCGTGTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA

Curator Acknowledgements

Curator	Description	Most Recent Edit

dfrA15

Prevalence: protein homolog model (view sequences)

Graph