dfrA15

Accession ARO:3003013
CARD Short NamedfrA15
DefinitiondfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAeromonas caviaewgs, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter werkmaniiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia albertiip, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Shigella sonneiwgs, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAeromonas caviaewgs, Aeromonas veroniiwgs, Citrobacter amalonaticuswgs, Citrobacter werkmaniiwgs, Corynebacterium diphtheriaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia albertiip, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Shewanella putrefaciensg+p, Shigella sonneiwgs, Vibrio choleraep+wgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Ceccarelli D, et al. 2006. J Antimicrob Chemother 58(5): 1095-1097. Prevalence of aadA1 and dfrA15 class 1 integron cassettes and SXT circulation in Vibrio cholerae O1 isolates from Africa. (PMID 16980697)

Resistomes

Prevalence of dfrA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Aeromonas caviae0%0%0.9%0%
Aeromonas veronii0%0%3.97%0%
Citrobacter amalonaticus0%0%2.08%0%
Citrobacter werkmanii0%0%9.52%0%
Corynebacterium diphtheriae0%0%0.39%0%
Enterobacter cloacae0%0%1.36%0%
Enterobacter hormaechei0%0.17%3.66%0%
Escherichia albertii0%2.63%0%0%
Escherichia coli0%0.04%0.27%0%
Klebsiella michiganensis0%0%0.65%0%
Klebsiella pneumoniae0%0.03%0.66%0%
Klebsiella quasipneumoniae0%0%0.9%0%
Morganella morganii0%0%2.08%0%
Providencia rettgeri0%3.03%0.86%0%
Pseudomonas aeruginosa0%0%0.04%0%
Salmonella enterica0%0.21%0.23%0%
Shewanella putrefaciens11.11%25%0%0%
Shigella sonnei0%0%0.15%0%
Vibrio cholerae0%6.25%0.14%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AHB39758.1|+|dfrA15 [Escherichia coli]
MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTI
TDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEIPSSFRPVFSQDFVSNINYSYQIWQKG


>gb|KF534911.1|+|40-513|dfrA15 [Escherichia coli]
GTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTA
CTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCC
GTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATA
ACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGTTGATACTTTACATATTTCAACAATCGACATT
GAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCAGTAGTTTTAGGCCAGTTTTTAGCCAAGACTTCGTGTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA