dfrA15

Download Sequences

Accession	ARO:3003013
CARD Short Name	dfrA15
Definition	dfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Family	trimethoprim resistant dihydrofolate reductase dfr
Drug Class	diaminopyrimidine antibiotic
Resistance Mechanism	antibiotic target replacement
Resistomes with Perfect Matches	Aeromonas caviae^wgs, Aeromonas veronii^wgs, Citrobacter amalonaticus^wgs, Citrobacter werkmanii^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Escherichia albertii^p, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Shigella sonnei^wgs, Vibrio cholerae^p+wgs
Resistomes with Sequence Variants	Aeromonas caviae^wgs, Aeromonas veronii^wgs, Citrobacter amalonaticus^wgs, Citrobacter werkmanii^wgs, Corynebacterium diphtheriae^wgs, Enterobacter cloacae^wgs, Enterobacter hormaechei^p+wgs, Escherichia albertii^p, Escherichia coli^p+wgs, Klebsiella michiganensis^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Morganella morganii^wgs, Providencia rettgeri^p+wgs, Pseudomonas aeruginosa^wgs, Salmonella enterica^p+wgs, Shewanella putrefaciens^g+p, Shigella sonnei^wgs, Vibrio cholerae^p+wgs
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic molecule + antibiotic target replacement [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic target replacement protein + diaminopyrimidine antibiotic [Drug Class] + trimethoprim [Antibiotic] + antibiotic resistant dihydrofolate reductase
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic trimethoprim [Antibiotic] + derives_from antibiotic sensitive dihydrofolate reductase + trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications	Ceccarelli D, et al. 2006. J Antimicrob Chemother 58(5): 1095-1097. Prevalence of aadA1 and dfrA15 class 1 integron cassettes and SXT circulation in Vibrio cholerae O1 isolates from Africa. (PMID 16980697)

Resistomes

Prevalence of dfrA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas caviae	0%	0%	0.9%	0%
Aeromonas caviae	0%	0%	0.9%	0%
Aeromonas veronii	0%	0%	3.97%	0%
Aeromonas veronii	0%	0%	3.97%	0%
Citrobacter amalonaticus	0%	0%	2.08%	0%
Citrobacter amalonaticus	0%	0%	2.08%	0%
Citrobacter werkmanii	0%	0%	9.52%	0%
Citrobacter werkmanii	0%	0%	9.52%	0%
Corynebacterium diphtheriae	0%	0%	0%	0%
Corynebacterium diphtheriae	0%	0%	0.39%	0%
Enterobacter cloacae	0%	0%	1.36%	0%
Enterobacter cloacae	0%	0%	1.36%	0%
Enterobacter hormaechei	0%	0.17%	3.66%	0%
Enterobacter hormaechei	0%	0.17%	3.42%	0%
Escherichia albertii	0%	2.63%	0%	0%
Escherichia albertii	0%	2.63%	0%	0%
Escherichia coli	0%	0.04%	0.27%	0%
Escherichia coli	0%	0.04%	0.27%	0%
Klebsiella michiganensis	0%	0%	0.65%	0%
Klebsiella michiganensis	0%	0%	0.65%	0%
Klebsiella pneumoniae	0%	0.03%	0.65%	0%
Klebsiella pneumoniae	0%	0.03%	0.66%	0%
Klebsiella quasipneumoniae	0%	0%	0.72%	0%
Klebsiella quasipneumoniae	0%	0%	0.9%	0%
Morganella morganii	0%	0%	2.08%	0%
Morganella morganii	0%	0%	2.08%	0%
Providencia rettgeri	0%	3.03%	0.86%	0%
Providencia rettgeri	0%	3.03%	0.86%	0%
Pseudomonas aeruginosa	0%	0%	0.02%	0%
Pseudomonas aeruginosa	0%	0%	0.04%	0%
Salmonella enterica	0%	0.21%	0.23%	0%
Salmonella enterica	0%	0.21%	0.23%	0%
Shewanella putrefaciens	0%	0%	0%	0%
Shewanella putrefaciens	11.11%	25%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%
Shigella sonnei	0%	0%	0.15%	0%
Vibrio cholerae	0%	6.25%	0.14%	0%
Vibrio cholerae	0%	6.25%	0.14%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300

Protein
DNA

>gb|AHB39758.1|+|dfrA15 [Escherichia coli]
MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTI
TDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEIPSSFRPVFSQDFVSNINYSYQIWQKG

>gb|KF534911.1|+|40-513|dfrA15 [Escherichia coli]
GTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTA
CTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCC
GTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATA
ACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGTTGATACTTTACATATTTCAACAATCGACATT
GAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCAGTAGTTTTAGGCCAGTTTTTAGCCAAGACTTCGTGTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA

dfrA15

Prevalence: protein homolog model (view sequences)

Graph