dfrA15

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003013
CARD Short NamedfrA15
DefinitiondfrA15 is an integron-encoded dihydrofolate reductase found in Vibrio cholerae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesAeromonas caviaewgs, Aeromonas veroniiwgs, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia albertiip, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Shigella sonneiwgs, Vibrio alginolyticusp, Vibrio choleraep+wgs
Resistomes with Sequence VariantsAeromonas caviaewgs, Aeromonas veroniiwgs, Alcaligenes faecaliswgs, Citrobacter amalonaticuswgs, Citrobacter freundiiwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Corynebacterium diphtheriaewgs, Enterobacter asburiaewgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Escherichia albertiip, Escherichia colip+wgs, Klebsiella michiganensiswgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaewgs, Morganella morganiiwgs, Proteus mirabiliswgs, Providencia rettgerip+wgs, Pseudomonas aeruginosawgs, Salmonella entericap+wgs, Shewanella putrefaciensg+p, Shigella sonneiwgs, Vibrio alginolyticusp, Vibrio choleraep+wgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Ceccarelli D, et al. 2006. J Antimicrob Chemother 58(5): 1095-1097. Prevalence of aadA1 and dfrA15 class 1 integron cassettes and SXT circulation in Vibrio cholerae O1 isolates from Africa. (PMID 16980697)

Resistomes

Prevalence of dfrA15 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Aeromonas caviae0%0%0.54%0%0%
Aeromonas veronii0%0%2.81%0%0%
Alcaligenes faecalis0%0%2.94%0%0%
Citrobacter amalonaticus0%0%1.82%0%0%
Citrobacter freundii0%0%0.39%0%0%
Citrobacter werkmanii0%0%2.56%0%0%
Citrobacter youngae0%0%6.25%0%0%
Corynebacterium diphtheriae0%0%0.63%0%0%
Enterobacter asburiae0%0%0.4%0%0%
Enterobacter cloacae0%0%2.56%0%0%
Enterobacter hormaechei0%1.03%5.48%0%0%
Escherichia albertii0%0.56%0%0%0%
Escherichia coli0%0.04%0.27%0%2.66%
Klebsiella michiganensis0%0%0.27%0%0%
Klebsiella pneumoniae0%0.03%0.64%0%0%
Klebsiella quasipneumoniae0%0%0.66%0%0%
Morganella morganii0%0%1.84%0%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia rettgeri0%2.7%0.64%0%0%
Pseudomonas aeruginosa0%0%0.03%0%0%
Salmonella enterica0%0.16%0.24%0%0%
Shewanella putrefaciens11.11%20%0%0%0%
Shigella sonnei0%0%0.15%0%0%
Vibrio alginolyticus0%3.57%0%0%0%
Vibrio cholerae0%5.26%0.19%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AHB39758.1|+|dfrA15 [Escherichia coli]
MKLSLMAAISKNGVIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSSFTSSDENVLVFPSIDEALNHLKTI
TDHVIVSGGGEIYKSLIDKVDTLHISTIDIEPEGDVYFPEIPSSFRPVFSQDFVSNINYSYQIWQKG


>gb|KF534911.1|+|40-513|dfrA15 [Escherichia coli]
GTGAAACTATCACTAATGGCAGCAATTTCGAAGAATGGAGTTATCGGAAATGGCCCAGATATTCCATGGAGTGCCAAAGGGGAACAATTA
CTCTTCAAAGCGATTACCTATAATCAGTGGCTTTTGGTAGGCCGAAAGACTTTCGAGTCAATGGGGGCTTTACCCAACCGAAAATATGCC
GTTGTAACTCGTTCAAGCTTCACTTCCAGTGATGAGAATGTATTGGTATTTCCATCTATCGATGAAGCGCTAAATCATCTGAAGACGATA
ACGGATCATGTGATTGTGTCTGGTGGTGGTGAAATATACAAAAGCCTGATCGATAAAGTTGATACTTTACATATTTCAACAATCGACATT
GAGCCAGAAGGTGATGTCTATTTTCCAGAAATCCCCAGTAGTTTTAGGCCAGTTTTTAGCCAAGACTTCGTGTCTAACATAAATTATAGT
TACCAAATCTGGCAAAAGGGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit