dfrA16

Accession ARO:3003014
DefinitiondfrA16 is an integron-encoded dihydrofolate reductase found in Salmonella enterica
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
ResistomesAcinetobacter baumanniiwgs, Citrobacter freundiiwgs, Enterobacter cloacaewgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia coliwgs, Proteus mirabilisg
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Murphy BP, et al. 2007. FEMS Microbiol Lett 266(2): 170-176. Investigation of a global collection of nontyphoidal Salmonella of various serotypes cultured between 1953 and 2004 for the presence of class 1 integrons. (PMID 17233727)

Resistomes

Prevalence of dfrA16 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.07%
Citrobacter freundii0%0%1.55%
Enterobacter cloacae0%0%4.06%
Enterobacter hormaechei0%2.7%2.06%
Enterobacter kobei0%0%7.81%
Escherichia coli0%0%0.03%
Proteus mirabilis4.35%0%0%
Shigella sonnei0%0%0.08%
Vibrio parahaemolyticus0%0%0.08%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AAK60186.1|+|dfrA16 [Escherichia coli]
MKLSLMAAKSKNGIIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSNFSTNDEGVMVFSSIQDALINLEEI
TDHVIVSGGGEIYKSLISKVDTLHISTVDIERDGDIVFPEIPDTFKLVFEQDFESNINYCYQIWQKS


>gb|AF174129|+|1352-1825|dfrA16 [Escherichia coli]
GTGAAGTTATCACTAATGGCTGCCAAGTCGAAGAACGGTATTATCGGTAATGGACCAGATATTCCATGGAGCGCCAAAGGCGAGCAACTT
CTATTTAAGGCAATTACATATAATCAATGGCTTTTAGTTGGACGCAAAACTTTTGAGTCAATGGGCGCTCTCCCAAATCGAAAGTATGCA
GTTGTAACTCGCTCTAATTTTTCTACGAATGATGAGGGTGTAATGGTTTTCTCCTCAATTCAGGATGCCTTAATAAATTTAGAGGAAATC
ACGGATCATGTTATCGTTTCTGGTGGTGGTGAAATATACAAAAGCTTGATTTCCAAAGTAGATACTTTGCATATTTCAACAGTCGACATC
GAGCGAGATGGAGACATAGTTTTTCCTGAAATCCCAGATACATTCAAGTTGGTATTTGAGCAAGATTTCGAGTCTAACATTAACTATTGT
TATCAAATCTGGCAAAAGAGTTAA