dfrA16

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003014
CARD Short NamedfrA16
DefinitiondfrA16 is an integron-encoded dihydrofolate reductase found in Salmonella enterica.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEscherichia coli (2)
GAZ
FOODON
ENVO
UBERON
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Resistomes with Perfect MatchesAcinetobacter baumanniip+wgs, Acinetobacter indicusp, Acinetobacter townerig+gi, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella pneumoniaewgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Salmonella entericawgs, Serratia marcescensp+wgs, Vibrio choleraeg+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniip+wgs, Acinetobacter indicusp, Acinetobacter townerig+gi, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Delftia tsuruhatensisgi, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Enterobacter roggenkampiip+wgs, Escherichia colip+wgs, Klebsiella aerogenesp, Klebsiella pneumoniaewgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Salmonella entericawgs, Serratia marcescensp+wgs, Vibrio choleraeg+wgs
Publications

Murphy BP, et al. 2007. FEMS Microbiol Lett 266(2): 170-176. Investigation of a global collection of nontyphoidal Salmonella of various serotypes cultured between 1953 and 2004 for the presence of class 1 integrons. (PMID 17233727)

Resistomes

Prevalence of dfrA16 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0%0.05%0.16%0%0%
Acinetobacter indicus0%9.43%0%0%0%
Acinetobacter towneri12.5%0%0%100%0%
Citrobacter freundii0%0.31%9.09%0%0%
Citrobacter portucalensis0%0%2.7%0%0%
Delftia tsuruhatensis0%0%0%100%0%
Enterobacter asburiae0%0.28%5.14%0%0%
Enterobacter cloacae0%1.12%0.64%0%0%
Enterobacter hormaechei0%0.58%2.72%0%0%
Enterobacter kobei0%0%6.11%0%0%
Enterobacter roggenkampii0%0.97%1.8%0%0%
Escherichia coli0%0.06%0.17%0%1.55%
Klebsiella aerogenes0%1.09%0%0%0%
Klebsiella pneumoniae0%0%0.14%0%0%
Morganella morganii0%0%0.61%0%0%
Proteus mirabilis2.75%0%0.5%0%0%
Proteus vulgaris0%0%5.56%0%0%
Salmonella enterica0%0%0.03%0%0%
Serratia marcescens0%0.65%3.54%0%0%
Vibrio cholerae0.45%0%0.51%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAK60186.1|+|dfrA16 [Escherichia coli]
MKLSLMAAKSKNGIIGNGPDIPWSAKGEQLLFKAITYNQWLLVGRKTFESMGALPNRKYAVVTRSNFSTNDEGVMVFSSIQDALINLEEI
TDHVIVSGGGEIYKSLISKVDTLHISTVDIERDGDIVFPEIPDTFKLVFEQDFESNINYCYQIWQKS


>gb|AF174129.3|+|1352-1825|dfrA16 [Escherichia coli]
GTGAAGTTATCACTAATGGCTGCCAAGTCGAAGAACGGTATTATCGGTAATGGACCAGATATTCCATGGAGCGCCAAAGGCGAGCAACTT
CTATTTAAGGCAATTACATATAATCAATGGCTTTTAGTTGGACGCAAAACTTTTGAGTCAATGGGCGCTCTCCCAAATCGAAAGTATGCA
GTTGTAACTCGCTCTAATTTTTCTACGAATGATGAGGGTGTAATGGTTTTCTCCTCAATTCAGGATGCCTTAATAAATTTAGAGGAAATC
ACGGATCATGTTATCGTTTCTGGTGGTGGTGAAATATACAAAAGCTTGATTTCCAAAGTAGATACTTTGCATATTTCAACAGTCGACATC
GAGCGAGATGGAGACATAGTTTTTCCTGAAATCCCAGATACATTCAAGTTGGTATTTGAGCAAGATTTCGAGTCTAACATTAACTATTGT
TATCAAATCTGGCAAAAGAGTTAA

Curator Acknowledgements
Curator Description Most Recent Edit