dfrA19

Accession ARO:3003015
DefinitiondfrA19 is an integron-encoded dihydrofolate reductase found in Klebsiella pneumoniae
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Classification10 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Rodriguez-Martinez JM, et al. 2007. Int J Antimicrob Agents 29(6): 705-709. Characterisation of integrons containing the plasmid-mediated quinolone resistance gene qnrA1 in Klebsiella pneumoniae. (PMID 17368003)

Resistomes

Prevalence of dfrA19 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.64%
Citrobacter freundii3.45%3.49%4.65%
Enterobacter asburiae0%0%10.94%
Enterobacter cloacae0%2.6%12.87%
Enterobacter hormaechei0%5.41%10.78%
Enterobacter kobei0%0%6.25%
Escherichia coli0%0%0.11%
Klebsiella oxytoca0%8.33%1.87%
Morganella morganii0%0%4.76%
Proteus mirabilis0%0%0.86%
Salmonella enterica0.39%0.35%0%
Serratia marcescens0%1.64%0.23%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|CAC81324.1|+|dfrA19 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSHPQLELIVAVDSKLGFGKGGKIPWKCKEDMARFTRISKEIRVCVIGKHTYTDMRDMQLEKDGAEERIKEKGILPERESFVISSTLKQE
DVIGATVVPDLRAVINLYENTDQRIAVIGGEKLYIQALSSATKLHMTIIPREFDCDRFIPVDPIQNNFHIDSSASETVEATVDETQERIH
FATYVRNNQ


>gb|AJ310778|+|7004-7573|dfrA19 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGAGTCACCCACAACTTGAGCTAATAGTCGCTGTGGATTCTAAGTTGGGATTCGGGAAAGGCGGCAAGATTCCATGGAAATGCAAAGAA
GACATGGCGCGATTTACGCGGATTTCTAAAGAGATCCGCGTGTGCGTTATAGGGAAACACACGTATACTGACATGCGTGACATGCAGTTA
GAAAAGGATGGCGCCGAGGAGCGAATCAAGGAGAAAGGAATTCTCCCCGAACGCGAATCGTTCGTGATCTCCTCGACGTTAAAACAAGAA
GATGTCATAGGCGCTACTGTCGTTCCTGATCTTCGTGCTGTGATCAACCTGTATGAGAATACCGATCAACGCATTGCTGTCATTGGTGGG
GAGAAGTTGTACATTCAAGCTCTTTCATCAGCAACGAAACTGCACATGACCATAATTCCAAGAGAGTTCGACTGTGATCGATTTATTCCT
GTTGATCCGATCCAGAACAATTTTCACATTGATTCCAGTGCCAGCGAGACTGTGGAGGCAACCGTTGATGAGACTCAAGAGCGCATTCAC
TTTGCTACTTACGTGCGTAACAATCAGTAA