dfrA19

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3003015
CARD Short NamedfrA19
DefinitiondfrA19 is an integron-encoded dihydrofolate reductase found in Klebsiella pneumoniae.
AMR Gene Familytrimethoprim resistant dihydrofolate reductase dfr
Drug Classdiaminopyrimidine antibiotic
Resistance Mechanismantibiotic target replacement
Resistomes with Sequence VariantsAcinetobacter baumanniig+p+wgs, Acinetobacter pittiip+wgs, Aeromonas hydrophilap+wgs, Citrobacter amalonaticusp+wgs, Citrobacter freundiig+p+wgs, Citrobacter koserip+wgs, Citrobacter portucalensisp+wgs, Citrobacter werkmaniiwgs, Cronobacter malonaticuswgs, Enterobacter asburiaep+wgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiiwgs, Escherichia colip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Leclercia adecarboxylatawgs, Morganella morganiig+wgs, Proteus mirabiliswgs, Providencia stuartiip, Raoultella planticolap+wgs, Salmonella entericap+wgs+gi, Serratia marcescensp+wgs
Classification15 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic trimethoprim [Antibiotic]
+ derives_from antibiotic sensitive dihydrofolate reductase
+ trimethoprim resistant dihydrofolate reductase dfr [AMR Gene Family]
Publications

Rodriguez-Martinez JM, et al. 2007. Int J Antimicrob Agents 29(6): 705-709. Characterisation of integrons containing the plasmid-mediated quinolone resistance gene qnrA1 in Klebsiella pneumoniae. (PMID 17368003)

Resistomes

Prevalence of dfrA19 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Acinetobacter baumannii0.18%0.1%0.26%0%0%
Acinetobacter pittii0%0.49%0.57%0%0%
Aeromonas hydrophila0%1.3%0.81%0%0%
Citrobacter amalonaticus0%8.33%1.82%0%0%
Citrobacter freundii0.82%3.08%7.74%0%0%
Citrobacter koseri0%15%4.5%0%0%
Citrobacter portucalensis0%13.24%17.12%0%0%
Citrobacter werkmanii0%0%56.41%0%0%
Cronobacter malonaticus0%0%1.82%0%0%
Enterobacter asburiae0%1.1%4.74%0%0%
Enterobacter cloacae0%1.12%7.35%0%0%
Enterobacter hormaechei0.36%2.64%12.78%0%0%
Enterobacter kobei0%0.69%3.49%0%0%
Enterobacter roggenkampii0%0%1.44%0%0%
Escherichia coli0%0.06%0.26%0%0%
Klebsiella aerogenes0%1.09%0.28%0%0%
Klebsiella michiganensis0%5.71%3.99%0%0%
Klebsiella oxytoca0%2.74%0.84%0%0%
Klebsiella pneumoniae0%0.08%0.44%0%0%
Klebsiella quasipneumoniae0%0.64%0%0%0%
Leclercia adecarboxylata0%0%34.88%0%0%
Morganella morganii1.92%0%4.29%0%0%
Proteus mirabilis0%0%0.17%0%0%
Providencia stuartii0%6.82%0%0%0%
Raoultella planticola0%6.98%12.82%0%0%
Salmonella enterica0%0.05%0.19%0.33%0%
Serratia marcescens0%2.58%0.52%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|CAC81324.1|+|dfrA19 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSHPQLELIVAVDSKLGFGKGGKIPWKCKEDMARFTRISKEIRVCVIGKHTYTDMRDMQLEKDGAEERIKEKGILPERESFVISSTLKQE
DVIGATVVPDLRAVINLYENTDQRIAVIGGEKLYIQALSSATKLHMTIIPREFDCDRFIPVDPIQNNFHIDSSASETVEATVDETQERIH
FATYVRNNQ


>gb|AJ310778.1|+|7004-7573|dfrA19 [Salmonella enterica subsp. enterica serovar Typhimurium]
ATGAGTCACCCACAACTTGAGCTAATAGTCGCTGTGGATTCTAAGTTGGGATTCGGGAAAGGCGGCAAGATTCCATGGAAATGCAAAGAA
GACATGGCGCGATTTACGCGGATTTCTAAAGAGATCCGCGTGTGCGTTATAGGGAAACACACGTATACTGACATGCGTGACATGCAGTTA
GAAAAGGATGGCGCCGAGGAGCGAATCAAGGAGAAAGGAATTCTCCCCGAACGCGAATCGTTCGTGATCTCCTCGACGTTAAAACAAGAA
GATGTCATAGGCGCTACTGTCGTTCCTGATCTTCGTGCTGTGATCAACCTGTATGAGAATACCGATCAACGCATTGCTGTCATTGGTGGG
GAGAAGTTGTACATTCAAGCTCTTTCATCAGCAACGAAACTGCACATGACCATAATTCCAAGAGAGTTCGACTGTGATCGATTTATTCCT
GTTGATCCGATCCAGAACAATTTTCACATTGATTCCAGTGCCAGCGAGACTGTGGAGGCAACCGTTGATGAGACTCAAGAGCGCATTCAC
TTTGCTACTTACGTGCGTAACAATCAGTAA

Curator Acknowledgements
Curator Description Most Recent Edit