mef(B)

Download Sequences

Accession	ARO:3003107
Synonym(s)	mefB
CARD Short Name	mef(B)
Definition	mef(B) is a macrolide efflux gene located in the vicinity of sul3 in Escherichia coli. There is also a mefB found in Streptococcus agalactiae that confers resistance to macrolides.
AMR Gene Family	major facilitator superfamily (MFS) antibiotic efflux pump
Drug Class	macrolide antibiotic
Resistance Mechanism	antibiotic efflux
Efflux Component	efflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect Matches	Avibacterium paragallinarum^g, Citrobacter werkmanii^wgs, Escherichia coli^g+p+wgs, Escherichia fergusonii^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Pasteurella multocida^g+gi, Salmonella enterica^p+wgs, Shigella boydii^wgs, Shigella dysenteriae^g, Shigella flexneri^p, Shigella sonnei^wgs
Resistomes with Sequence Variants	Avibacterium paragallinarum^g, Citrobacter werkmanii^wgs, Escherichia coli^g+p+wgs+gi, Escherichia fergusonii^wgs, Klebsiella pneumoniae^p+wgs, Klebsiella quasipneumoniae^wgs, Pasteurella multocida^g+gi, Salmonella enterica^p+wgs+gi, Shigella boydii^wgs, Shigella dysenteriae^g, Shigella flexneri^p, Shigella sonnei^wgs
Classification	8 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + determinant of antibiotic resistance + antibiotic efflux [Resistance Mechanism] + efflux pump complex or subunit conferring antibiotic resistance [Efflux Component] + antibiotic molecule + major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family] + macrolide antibiotic [Drug Class]
Parent Term(s)	3 ontology terms \| Show + confers_resistance_to_antibiotic erythromycin [Antibiotic] + confers_resistance_to_antibiotic azithromycin [Antibiotic] + mef
Publications	Kumar S, et al. 2016. Infect Disord Drug Targets 16(1):28-43 Bacterial Multidrug Efflux Pumps of the Major Facilitator Superfamily as Targets for Modulation. (PMID 27052334) Liu J, et al. 2009. J Antimicrob Chemother 63(3): 423-426. Characterization of a novel macrolide efflux gene, mef(B), found linked to sul3 in porcine Escherichia coli. (PMID 19131424)

Resistomes

Prevalence of mef(B) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI	GRDI-AMR2
Avibacterium paragallinarum	6.25%	0%	0%	0%	0%
Avibacterium paragallinarum	6.25%	0%	0%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Citrobacter werkmanii	0%	0%	2.56%	0%	0%
Escherichia coli	0.07%	0.24%	1%	0.38%	0.31%
Escherichia coli	0.07%	0.24%	1%	0%	0.31%
Escherichia fergusonii	0%	0%	1.09%	0%	0%
Escherichia fergusonii	0%	0%	1.09%	0%	0%
Klebsiella pneumoniae	0%	0.14%	0.18%	0%	0%
Klebsiella pneumoniae	0%	0.14%	0.18%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Klebsiella quasipneumoniae	0%	0%	0.13%	0%	0%
Pasteurella multocida	0.71%	0%	0%	16.67%	0%
Pasteurella multocida	0.71%	0%	0%	16.67%	0%
Salmonella enterica	0%	0.11%	0.1%	0%	0%
Salmonella enterica	0%	0.11%	0.1%	0.66%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella boydii	0%	0%	2.22%	0%	0%
Shigella dysenteriae	14.29%	0%	0%	0%	0%
Shigella dysenteriae	14.29%	0%	0%	0%	0%
Shigella flexneri	0%	0.8%	0%	0%	0%
Shigella flexneri	0%	0.8%	0%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%	0%
Shigella sonnei	0%	0%	0.15%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 800

Protein
DNA

>gb|ACJ63262.1|-|mef(B) [Escherichia coli]
MNRIKNWKKQFAVIYTGQAFSILGSAAVQFAVIWWLTIQTESAITLTIASLVAFLPNMLIGPFAGVWIDRYNRRTVMILADGLVAVSSII
LGAAFLLVETPPIWFIYIVLFLRGLGNTFHGPAMQAAIPMFVPADMLTKAGGWGNMIQSISNMMGPVLGAALMSFLPISSIMIVDILGAA
FAIVCLLFVIIPDITQTNEKMSVLSDMKQGFIAMKANKPLMAVFSPMLLMTILYMPLGSLFPLLARSHFMGEAWHNSIVEFVFAGGLLLS
SLVIGVWGGMKRRFFMASLAIGLMGLATLISGALPTSGFWIFVICCFFLGASGTFMNVPVMAYVQESIAPEMMGKVFSLLMTAMTLSMPI
GLLVAGPVVEVIGVNTWFFWSGVALIVNAVLCRILTRRYDKVTMKPQVD

>gb|FJ196385.1|-|11084-12313|mef(B) [Escherichia coli]
ATGAACAGAATAAAAAATTGGAAGAAACAATTTGCTGTAATATACACAGGGCAGGCTTTTTCAATCTTGGGTTCTGCCGCAGTGCAGTTC
GCTGTTATCTGGTGGCTGACCATCCAGACTGAATCCGCAATCACCTTGACGATTGCATCCTTAGTTGCCTTTCTCCCCAATATGTTAATC
GGACCCTTTGCCGGTGTGTGGATCGACCGATACAACCGCCGAACAGTAATGATTTTAGCTGACGGTCTGGTAGCTGTATCCAGCATCATC
CTTGGGGCAGCATTTTTACTTGTGGAAACACCCCCTATTTGGTTTATCTACATTGTTTTATTTTTGCGTGGATTGGGGAATACCTTTCAC
GGTCCAGCTATGCAAGCGGCGATACCCATGTTTGTGCCAGCAGATATGTTGACCAAAGCAGGGGGCTGGGGAAATATGATCCAATCAATA
TCCAACATGATGGGGCCTGTGCTGGGTGCTGCGCTTATGTCATTTCTACCTATTTCCTCCATTATGATTGTGGATATACTGGGAGCCGCT
TTTGCGATAGTTTGCCTCCTATTTGTTATAATTCCAGACATTACGCAAACCAATGAGAAGATGAGTGTATTGTCTGACATGAAGCAGGGC
TTTATCGCAATGAAAGCAAATAAACCTTTAATGGCTGTGTTTTCCCCCATGCTGCTGATGACCATACTTTATATGCCATTAGGTTCTCTG
TTCCCTCTACTGGCACGCAGCCACTTTATGGGTGAAGCCTGGCACAATAGCATTGTGGAATTTGTCTTTGCAGGTGGATTGCTTCTTTCA
TCTTTGGTTATCGGTGTATGGGGCGGCATGAAAAGAAGGTTTTTCATGGCATCCTTAGCTATTGGCTTAATGGGTCTGGCTACACTGATT
AGCGGAGCGCTACCGACAAGCGGTTTTTGGATATTTGTTATATGCTGCTTCTTCTTGGGCGCCTCTGGCACATTTATGAATGTTCCTGTT
ATGGCTTATGTTCAAGAAAGCATTGCCCCTGAAATGATGGGCAAGGTGTTTTCCCTTTTGATGACCGCCATGACTCTTTCTATGCCGATA
GGCTTACTTGTTGCAGGTCCGGTTGTTGAGGTTATAGGTGTTAATACATGGTTTTTCTGGTCTGGTGTTGCGTTGATAGTAAACGCTGTT
CTCTGCCGCATTCTGACACGACGCTATGACAAAGTAACAATGAAACCGCAAGTGGACTGA

Curator Acknowledgements

Curator	Description	Most Recent Edit

mef(B)

Prevalence: protein homolog model (view sequences)

Graph