msrE

Accession ARO:3003109
Synonym(s)msr(E)
DefinitionMsrE is an ABC-F subfamily protein expressed to Klebsiella pneumoniae that confers resistance to erythromycin and streptogramin B antibiotics. It is associated with plasmid DNA. It is also 100% identical to ABC-F type ribosomal protection protein Msr(E) which is in multiple species.
AMR Gene FamilyABC-F ATP-binding cassette ribosomal protection protein
Drug Classlincosamide antibiotic, streptogramin antibiotic, pleuromutilin antibiotic, macrolide antibiotic, phenicol antibiotic, tetracycline antibiotic, oxazolidinone antibiotic
Resistance Mechanismantibiotic target protection
ResistomesAcinetobacter baumanniig+p+wgs, Acinetobacter lwoffiiwgs, Acinetobacter nosocomialisp+wgs, Citrobacter freundiip+wgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheip+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella oxytocap+wgs, Morganella morganiiwgs, Proteus mirabilisg+p+wgs, Proteus vulgariswgs, Providencia rettgerig+wgs, Providencia stuartiip+wgs, Pseudomonas stutzeriwgs, Raoultella planticolawgs, Salmonella entericawgs, Serratia marcescensp, Vibrio choleraewgs
Classification16 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_drug_class macrolide antibiotic [Drug Class]
+ confers_resistance_to_drug_class streptogramin antibiotic [Drug Class]
+ msr-type ABC-F protein
Publications

Bonnin RA, et al. 2012. Antimicrob Agents Chemother 57(1): 674-676. Comparative genomics of IncL/M-type plasmids: evolution by acquisition of resistance genes and insertion sequences. (PMID 23114767)

Resistomes

Prevalence of msrE among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii40.76%6.1%46.62%
Acinetobacter haemolyticus0%6.67%0%
Acinetobacter junii0%0%0%
Acinetobacter lwoffii0%0%7.14%
Acinetobacter nosocomialis0%2%2%
Citrobacter freundii0%4.65%7.75%
Enterobacter asburiae0%0%1.56%
Enterobacter cloacae0%1.3%2.26%
Enterobacter hormaechei0%0.9%3.33%
Enterobacter kobei0%0%14.06%
Escherichia coli0.07%0.16%0.05%
Klebsiella oxytoca0%3.33%1.87%
Klebsiella pneumoniae0%0%0%
Morganella morganii0%0%7.14%
Proteus mirabilis4.35%7.41%0.86%
Proteus vulgaris0%0%12.5%
Providencia rettgeri25%0%38.46%
Providencia stuartii0%7.14%7.69%
Pseudomonas aeruginosa0%0%0%
Pseudomonas stutzeri0%0%4.48%
Raoultella planticola0%0%10.53%
Salmonella enterica0%0%0.05%
Serratia marcescens0%1.64%0%
Staphylococcus aureus0%0%0.01%
Vibrio cholerae0%0%0.32%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 950


>gb|ACB05808.1|+|msrE [Acinetobacter baumannii]
MSLIIKARNIRLDYAGRDVLDIDELEIHSYDRIGLVGDNGAGKSSLLKVLNGEIVLAEATLQRFGDFAHISQLGGIEIETVEDRAMLSRL
GVSNVQNDTMSGGEETRAKIAAAFSQQVHGILADEPTSHLDLNGIDLLIGQLKAFDGALLVISHDRYFLDMVVDKIWELKDGKITEYWGG
YSDYLRQKEEERQHQAVEYELMMKERERLESAVQEKRQQANRLDNKKKGEKSKNSTESAGRLGHAKMTGTKQRKLYQAAKSMEKRLAALE
DIQAPEHLRSIRFRQSSALELHNKFPITADGLSLKFGSRTIFDDANFIIPLGAKVAITGSNGTGKTSLLKMISERADGLTISPKAEIGYF
TQTGYKFNTHKSVLSFMQEECEYTVAEIRAVLASMGIGANDIQKNLSDLSGGEIIKLLLSKMLLGKYNILLMDEPGNYLDLKSIAALETM
MKSYAGTIIFVSHDKQLVDNIADIIYEIKDHKIIKTFERDC


>gb|EU294228.1|+|21242-22717|msrE [Acinetobacter baumannii]
ATGAGTTTAATTATTAAAGCGAGAAACATACGCTTGGATTATGCTGGGCGTGATGTTTTGGATATTGATGAATTGGAAATTCACTCTTAT
GACCGTATTGGTCTTGTGGGTGATAACGGAGCAGGAAAGAGTAGTTTACTCAAAGTACTTAATGGCGAAATTGTTTTAGCCGAAGCGACA
TTACAGCGTTTTGGTGATTTTGCACATATCAGCCAACTGGGCGGAATCGAAATAGAAACGGTCGAAGACCGGGCAATGTTATCTCGCCTT
GGTGTTTCCAATGTACAAAACGACACAATGAGTGGCGGAGAGGAAACTCGTGCAAAAATTGCTGCCGCATTTTCCCAACAAGTACATGGC
ATTCTAGCGGATGAACCAACCAGCCACCTTGATCTCAATGGAATAGATCTACTTATTGGTCAACTTAAAGCATTTGATGGAGCATTACTT
GTTATCAGTCATGACCGATATTTTCTTGATATGGTTGTAGACAAGATATGGGAGTTAAAAGACGGTAAAATTACGGAATATTGGGGTGGT
TACTCGGATTACTTGCGTCAAAAAGAAGAAGAGCGACAACACCAAGCCGTAGAATATGAGCTGATGATGAAGGAACGGGAGCGATTAGAA
TCTGCTGTGCAAGAAAAACGCCAGCAAGCTAATCGATTAGACAATAAGAAAAAAGGAGAAAAATCCAAAAACTCTACCGAAAGTGCTGGA
CGACTTGGGCATGCAAAAATGACTGGCACCAAGCAAAGAAAACTGTATCAGGCAGCTAAGAGTATGGAAAAGCGTTTGGCTGCATTAGAA
GATATTCAAGCACCAGAGCATTTGCGTTCTATTCGTTTTCGTCAAAGTTCAGCCCTAGAACTGCACAATAAGTTCCCGATTACGGCAGAT
GGTCTGAGCTTAAAATTTGGTAGCCGTACTATCTTTGATGACGCTAACTTTATAATACCGCTTGGCGCTAAAGTCGCTATAACTGGATCG
AATGGAACAGGGAAAACGTCCTTGTTAAAAATGATATCAGAACGTGCTGATGGATTAACCATATCTCCAAAAGCTGAAATTGGCTACTTT
ACACAAACAGGATATAAATTTAACACGCATAAATCTGTGCTCTCCTTTATGCAGGAAGAGTGCGAGTACACAGTTGCGGAAATTCGTGCA
GTATTGGCTTCAATGGGGATCGGAGCGAATGATATTCAAAAAAACTTATCCGACTTATCGGGAGGTGAAATCATCAAACTGCTTTTATCC
AAAATGCTTTTAGGAAAATATAATATTTTGCTTATGGATGAACCAGGAAACTATCTTGACCTAAAAAGTATTGCCGCATTAGAAACAATG
ATGAAGTCCTATGCAGGAACTATTATCTTCGTATCTCATGACAAGCAATTGGTCGATAATATTGCTGACATTATCTACGAGATCAAAGAC
CACAAAATCATCAAGACTTTTGAGAGAGATTGTTAA