y56 beta-lactamase

Accession ARO:3003558
CARD Short NameYent_y56
DefinitionClass A beta-lactamase found in Yersinia enterocolitica biovar 1A.
AMR Gene FamilyBlaA beta-lactamase
Drug Classpenem, penam, cephalosporin
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesYersinia enterocoliticag
Resistomes with Sequence VariantsYersinia enterocoliticag
Classification15 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ BlaA beta-lactamase [AMR Gene Family]
+ confers_resistance_to_antibiotic ticarcillin [Antibiotic]
Publications

Sharma S, et al. 2006. FEMS Microbiol Lett 257(2): 319-327. Molecular characterization of beta-lactamase genes blaA and blaB of Yersinia enterocolitica biovar 1A. (PMID 16553870)

Resistomes

Prevalence of y56 beta-lactamase among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 381 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Yersinia enterocolitica57.89%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 550


>gb|AAX55643.1|+|y56 beta-lactamase [Yersinia enterocolitica]
MKHSSLRRALLLAGITLPLVNFSLPTWAAAIPGSLDKQLAALEHSANGRLGIAMINTGNGTKILYRGARRFPFCSTFKFMLAAAVLGQSQ
SQPNLLNKHINYHESDLLSYAPITRKNLAHGMTVSELCAATIQYSDNTAANLLLKELGGLAAVNQFARSIGDQMFRLDRWEPDLNTALPN
DPRDTTTPAAMAASINKLVLGDALHPAQRSQLTAWLKGNTTGDATIRAGAPTDWIVGDKTGSGDYGTTNDIAVLWPTKGAPIVLVVYFTQ
REKDAKPRRDVLASATKIILSQIS


>gb|AY954728.1|+|12-896|y56 beta-lactamase [Yersinia enterocolitica]
ATGAAGCACTCTTCGCTACGGCGTGCGCTATTATTAGCCGGTATTACCCTGCCCTTAGTCAATTTTTCGCTGCCAACCTGGGCCGCTGCG
ATTCCGGGGTCATTAGACAAGCAATTGGCAGCACTTGAGCACAGTGCTAACGGTCGTTTAGGCATTGCGATGATTAATACCGGCAATGGC
ACCAAAATTCTGTATCGCGGAGCTCGACGTTTCCCATTCTGTAGTACTTTTAAGTTTATGTTAGCCGCTGCTGTATTGGGTCAAAGCCAA
TCTCAGCCGAATTTGCTCAATAAGCATATCAATTACCATGAGAGTGATTTGTTATCTTATGCCCCCATCACGCGTAAAAATCTGGCGCAT
GGTATGACAGTTTCTGAATTATGTGCGGCTACCATTCAATATAGCGATAACACGGCCGCGAATTTATTACTTAAAGAGTTGGGTGGTTTA
GCGGCTGTTAATCAGTTTGCTCGCAGTATTGGCGATCAGATGTTCAGGTTAGACCGCTGGGAACCGGATTTAAACACCGCACTACCTAAT
GACCCACGTGATACCACCACTCCTGCGGCTATGGCAGCTAGTATAAATAAATTGGTATTGGGTGATGCATTGCACCCTGCCCAACGAAGC
CAACTCACGGCATGGCTGAAAGGAAACACCACCGGGGATGCCACGATTCGCGCGGGTGCCCCTACTGACTGGATTGTGGGTGACAAAACA
GGTAGTGGCGATTACGGAACCACCAATGATATTGCGGTACTTTGGCCGACGAAAGGTGCACCGATTGTTTTAGTGGTGTATTTCACGCAA
CGTGAAAAAGATGCGAAGCCACGTCGCGATGTATTGGCCTCTGCGACCAAAATAATTTTGTCGCAAATATCCTGA