mphG

Accession ARO:3003742
CARD Short NamemphG
DefinitionThe mphG gene encodes a macrolide 2'-phosphotransferase found in Photobacterium damselae sharing sequence similarity to mphA in E. coli.
AMR Gene Familymacrolide phosphotransferase (MPH)
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAlcaligenes faecaliswgs, Escherichia coliwgs
Resistomes with Sequence VariantsAlcaligenes faecaliswgs, Elizabethkingia anopheliswgs, Escherichia coliwgs
Classification9 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ macrolide phosphotransferase (MPH) [AMR Gene Family]
Publications

Nonaka L, et al. 2015. Lett. Appl. Microbiol. 61(1):1-6 Novel macrolide-resistance genes, mef(C) and mph(G), carried by plasmids from Vibrio and Photobacterium isolated from sediment and seawater of a coastal aquaculture site. (PMID 25765542)

Pawlowski AC, et al. 2018. Nat Commun 9(1):112 The evolution of substrate discrimination in macrolide antibiotic resistance enzymes. (PMID 29317655)

Resistomes

Prevalence of mphG among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Alcaligenes faecalis0%0%3.85%0%
Elizabethkingia anophelis0%0%2.35%0%
Escherichia coli0%0%0.01%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|BAL43359.1|-|mphG [Photobacterium damselae subsp. damselae]
MKNRDIQKLAERNGLILSDEMSFNEMGIDFKVGFATDRDGTKWLLRIPRRTTLGEQIANEKRILQLVSKYLSVQVPDWRIANEKLVAYPL
LDGKPALTYDAETYEVTWNMSKENDLYIPSLAKALIELHSIPTEEVLRNNLKILTPEQVRNEISERLILVKSELGINAELELRYQKWLDN
DALWPNFTKFIHGDLYAGHTLTHHNGEVCGIIDWSTAQVSDIAQDFSGHVTVFGEESLKNLIAAYEKQGGEVWDKLFEQAVERAAAAPLA
YGYFALETQDEIHLSSAKLQLGVE


>gb|AB571865.1|-|143424-144308|mphG [Photobacterium damselae subsp. damselae]
ATGAAAAATAGAGATATTCAAAAATTAGCGGAAAGAAATGGGTTAATTCTTTCGGATGAAATGAGTTTTAATGAAATGGGAATTGATTTT
AAGGTTGGTTTCGCTACAGATAGGGATGGCACAAAGTGGTTGTTGCGTATTCCAAGAAGAACAACCTTAGGCGAACAGATTGCGAATGAG
AAACGCATTCTTCAATTGGTGTCGAAATACCTTTCGGTTCAAGTTCCTGATTGGCGTATAGCTAATGAAAAACTGGTAGCCTATCCTTTG
CTCGATGGAAAACCTGCACTTACTTATGATGCGGAGACTTATGAAGTAACCTGGAATATGTCTAAAGAAAACGACCTTTATATACCATCA
TTAGCGAAAGCACTTATAGAACTTCATTCAATTCCTACGGAAGAAGTACTTCGTAATAATCTAAAAATTTTGACACCTGAACAGGTTAGA
AATGAGATTTCTGAAAGATTGATTTTGGTGAAATCTGAATTAGGGATAAATGCCGAATTAGAACTTCGGTACCAAAAATGGCTGGATAAT
GATGCCTTATGGCCGAATTTTACAAAATTCATTCACGGTGATTTGTATGCAGGTCATACACTTACTCATCATAATGGAGAAGTTTGTGGA
ATTATTGATTGGTCAACTGCACAAGTCAGCGATATAGCACAAGATTTTTCAGGTCACGTTACTGTTTTCGGTGAAGAAAGTCTGAAAAAT
TTAATTGCGGCATACGAAAAACAAGGTGGAGAAGTATGGGATAAACTGTTTGAACAAGCAGTTGAACGAGCTGCTGCCGCACCTCTAGCT
TATGGATATTTTGCTTTAGAAACACAAGATGAAATTCATCTTAGTTCTGCAAAATTACAGTTAGGTGTTGAGTAG