carO

Accession ARO:3003808
DefinitioncarO is a transmembrane beta-barrel involved in the influx of carbapenem antibiotics in Acinetobacter baumannii. Disruption of the carO gene by distinct insertion elements results in a loss of carO expression causing resistance to carbapenem antibiotics. Homologs of carO have been identified in genera Acinetobacter, Moraxella and Psychrobacter.
AMR Gene FamilyCarO porin
Drug Classcarbapenem
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification9 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Mussi MA, et al. 2005. Antimicrob Agents Chemother 49(4): 1432-1440. Acquisition of resistance to carbapenems in multidrug-resistant clinical strains of Acinetobacter baumannii: natural insertional inactivation of a gene encoding a member of a novel family of beta-barrel outer membrane proteins. (PMID 15793123)

Resistomes

Prevalence of carO among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Bit-score Cut-off (blastP): 425


>gb|AKL79742.1|+|CarO [Acinetobacter baumannii]
MKVLRVLVTTTALLAAGAAMADEAVVHDSYAFDKNQLIPVGARAEVGTTGYGGALLWQANPYVGLALGYNGGDISWRDDLSINGTKYDVD
MDNNNVYLNAEIRPWGASTNRWAQGLYVAAGAAYLDNDYDLTKRSQDGTIKVNGNNYNFNGSVDGKLSYKNDIAPYLGFGFAPKINKNWG
VFGEVGAYYTGNPTVNLKSNGTFVNVNGADFDKDLRAEENKIRNDDKYQWLPVGKVGVNFFW


>gb|KP658477.1|+|1-729|CarO [Acinetobacter baumannii]
ATGAAAGTATTACGTGTTTTAGTGACAACTACAGCTTTACTTGCTGCTGGTGCTGCAATGGCGGATGAAGCTGTTGTTCATGACAGCTAT
GCATTCGATAAAAACCAATTAATTCCAGTAGGCGCTCGTGCTGAAGTAGGTACTACAGGTTACGGTGGTGCTTTGTTATGGCAAGCAAAC
CCATATGTAGGTTTAGCATTGGGTTATAACGGCGGTGACATTTCTTGGCGAGATGACTTATCAATTAATGGTACTAAATATGACGTTGAT
ATGGATAATAACAACGTATATTTAAATGCCGAAATTCGCCCATGGGGTGCAAGTACTAACCGTTGGGCTCAAGGCTTATATGTAGCTGCA
GGTGCGGCGTATTTAGATAACGATTATGACCTAACTAAACGTTCACAAGATGGGACTATTAAAGTAAATGGTAATAATTATAACTTTAAT
GGGTCAGTGGATGGTAAATTAAGTTATAAAAATGATATCGCTCCTTATTTAGGTTTTGGTTTTGCACCTAAAATCAATAAAAACTGGGGC
GTATTCGGTGAAGTAGGTGCTTACTATACTGGTAACCCAACAGTAAATCTTAAATCAAATGGTACTTTTGTTAATGTTAACGGTGCTGAC
TTTGATAAAGATTTACGTGCTGAAGAAAATAAAATCCGTAACGACGATAAATATCAATGGTTGCCAGTTGGTAAAGTTGGTGTGAACTTC
TTCTGGTAA