Mrx

Download Sequences

Accession	ARO:3003839
CARD Short Name	Mrx
Definition	Mrx is part of the macrolide inactivation gene cluster in Aeromonas hydrophila.
AMR Gene Family	macrolide phosphotransferase (MPH)
Drug Class	macrolide antibiotic
Resistance Mechanism	antibiotic inactivation
Resistomes with Perfect Matches	Aeromonas caviae^g+p, Aeromonas hydrophila^g+p, Aeromonas veronii^g+p, Alcaligenes faecalis^p, Bordetella trematum^g, Citrobacter amalonaticus^p, Citrobacter freundii^p, Citrobacter koseri^g+p, Citrobacter portucalensis^p, Citrobacter youngae^p, Comamonas testosteroni^p, Cronobacter sakazakii^p, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^p, Enterobacter kobei^p, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^g+p, Escherichia fergusonii^p, Klebsiella aerogenes^g+p, Klebsiella michiganensis^g+p, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p, Klebsiella quasipneumoniae^p, Leclercia adecarboxylata^g+p, Morganella morganii^g+p, Proteus mirabilis^g+p, Providencia rettgeri^g, Providencia stuartii^p, Pseudomonas aeruginosa^g+p, Raoultella planticola^p, Salmonella enterica^g+p, Serratia marcescens^p, Shewanella putrefaciens^p, Shigella flexneri^g+p, Shigella sonnei^g+p, Vibrio cholerae^g+p
Resistomes with Sequence Variants	Aeromonas caviae^g+p, Aeromonas hydrophila^g+p, Aeromonas veronii^g+p, Alcaligenes faecalis^p, Bordetella trematum^g, Citrobacter amalonaticus^p, Citrobacter freundii^g+p, Citrobacter koseri^g+p, Citrobacter portucalensis^p, Citrobacter youngae^p, Comamonas testosteroni^p, Cronobacter sakazakii^p, Enterobacter asburiae^p, Enterobacter cloacae^p, Enterobacter hormaechei^p, Enterobacter kobei^p, Enterobacter roggenkampii^p, Escherichia albertii^p, Escherichia coli^g+p, Escherichia fergusonii^p, Klebsiella aerogenes^g+p, Klebsiella michiganensis^g+p, Klebsiella oxytoca^p, Klebsiella pneumoniae^g+p, Klebsiella quasipneumoniae^p, Leclercia adecarboxylata^g+p, Morganella morganii^g+p, Proteus mirabilis^g+p, Providencia rettgeri^g, Providencia stuartii^p, Pseudomonas aeruginosa^g+p, Raoultella planticola^p, Salmonella enterica^g+p, Serratia marcescens^p, Shewanella putrefaciens^p, Shigella flexneri^g+p, Shigella sonnei^g+p, Vibrio cholerae^g+p
Classification	9 ontology terms \| Show + process or component of antibiotic biology or chemistry + mechanism of antibiotic resistance + antibiotic inactivation [Resistance Mechanism] + determinant of antibiotic resistance + antibiotic inactivation enzyme + antibiotic molecule + macrolide antibiotic [Drug Class] + macrolide inactivation enzyme + phosphorylation of antibiotic conferring resistance
Parent Term(s)	4 ontology terms \| Show + macrolide phosphotransferase (MPH) [AMR Gene Family] + confers_resistance_to_antibiotic erythromycin [Antibiotic] + confers_resistance_to_antibiotic azithromycin [Antibiotic] + confers_resistance_to_antibiotic tylosin [Antibiotic]
Publications	Poole TL, et al. 2005. J Antimicrob Chemother 57(1): 31-38. Macrolide inactivation gene cluster mphA-mrx-mphR adjacent to a class 1 integron in Aeromonas hydrophila isolated from a diarrhoeic pig in Oklahoma. (PMID 16339607)

Resistomes

Prevalence of Mrx among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 381 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

Species	NCBI Chromosome	NCBI Plasmid	NCBI WGS	NCBI GI
Aeromonas caviae	22.73%	7.79%	0%	0%
Aeromonas caviae	25%	7.79%	0%	0%
Aeromonas hydrophila	10.77%	5.19%	0%	0%
Aeromonas hydrophila	10.77%	5.19%	0%	0%
Aeromonas veronii	10.91%	4.62%	0%	0%
Aeromonas veronii	10.91%	4.62%	0%	0%
Alcaligenes faecalis	0%	20%	0%	0%
Alcaligenes faecalis	0%	20%	0%	0%
Bordetella trematum	20%	0%	0%	0%
Bordetella trematum	20%	0%	0%	0%
Citrobacter amalonaticus	0%	25%	0%	0%
Citrobacter amalonaticus	0%	25%	0%	0%
Citrobacter freundii	0.82%	9.85%	0%	0%
Citrobacter freundii	0%	9.85%	0%	0%
Citrobacter koseri	6.25%	15%	0%	0%
Citrobacter koseri	6.25%	15%	0%	0%
Citrobacter portucalensis	0%	25%	0%	0%
Citrobacter portucalensis	0%	25%	0%	0%
Citrobacter youngae	0%	9.09%	0%	0%
Citrobacter youngae	0%	9.09%	0%	0%
Comamonas testosteroni	0%	50%	0%	0%
Comamonas testosteroni	0%	50%	0%	0%
Cronobacter sakazakii	0%	2.56%	0%	0%
Cronobacter sakazakii	0%	2.56%	0%	0%
Enterobacter asburiae	0%	0.83%	0%	0%
Enterobacter asburiae	0%	0.83%	0%	0%
Enterobacter cloacae	0%	1.68%	0%	0%
Enterobacter cloacae	0%	1.68%	0%	0%
Enterobacter hormaechei	0%	3.93%	0%	0%
Enterobacter hormaechei	0%	3.8%	0%	0%
Enterobacter kobei	0%	1.38%	0%	0%
Enterobacter kobei	0%	1.38%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%
Enterobacter roggenkampii	0%	0.48%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%
Escherichia albertii	0%	0.56%	0%	0%
Escherichia coli	1.95%	4.06%	0%	0%
Escherichia coli	1.98%	4.24%	0%	0%
Escherichia fergusonii	0%	1.07%	0%	0%
Escherichia fergusonii	0%	1.07%	0%	0%
Klebsiella aerogenes	2%	5.43%	0%	0%
Klebsiella aerogenes	2%	4.35%	0%	0%
Klebsiella michiganensis	9.68%	12.57%	0%	0%
Klebsiella michiganensis	9.68%	12.57%	0%	0%
Klebsiella oxytoca	0%	2.74%	0%	0%
Klebsiella oxytoca	0%	2.74%	0%	0%
Klebsiella pneumoniae	1.07%	5.21%	0%	0%
Klebsiella pneumoniae	1.07%	5.28%	0%	0%
Klebsiella quasipneumoniae	0%	2.54%	0%	0%
Klebsiella quasipneumoniae	0%	2.54%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	0%	0%
Leclercia adecarboxylata	7.14%	4.76%	0%	0%
Morganella morganii	17.31%	10%	0%	0%
Morganella morganii	17.31%	10%	0%	0%
Proteus mirabilis	5.5%	6.25%	0%	0%
Proteus mirabilis	5.5%	6.25%	0%	0%
Providencia rettgeri	5.88%	0%	0%	0%
Providencia rettgeri	5.88%	0%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%
Providencia stuartii	0%	2.27%	0%	0%
Pseudomonas aeruginosa	0.46%	0.29%	0%	0%
Pseudomonas aeruginosa	0.46%	0.29%	0%	0%
Raoultella planticola	0%	11.63%	0%	0%
Raoultella planticola	0%	11.63%	0%	0%
Salmonella enterica	1.64%	3.06%	0%	0%
Salmonella enterica	1.7%	3.17%	0%	0%
Serratia marcescens	0%	1.29%	0%	0%
Serratia marcescens	0%	1.29%	0%	0%
Shewanella putrefaciens	0%	40%	0%	0%
Shewanella putrefaciens	0%	40%	0%	0%
Shigella flexneri	3%	7.63%	0%	0%
Shigella flexneri	3%	7.63%	0%	0%
Shigella sonnei	2.44%	5.83%	0%	0%
Shigella sonnei	2.44%	5.83%	0%	0%
Vibrio cholerae	0.45%	10.53%	0%	0%
Vibrio cholerae	0.45%	10.53%	0%	0%

Show Perfect Only

Detection Models

protein homolog model

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 600

Protein
DNA

>gb|AAS13767.1|-|Mrx [Aeromonas hydrophila]
MSERRYSPLATLFAATFLFRIGNAVAALALPWFVLSHTKSAAWAGATAASSVIATIIGAWVGGGLVDRFGRAPVALISGVVGGVAMASIP
LLDAVGALSNTGLIACVVLGAAFDAPGMAAQDSELPKLGHVAGLSVERVSSLKAVIGNVAILGGPALGGAAIGLLGAAPTLGLTAFCSVL
AGLLGAWVLPARAARTMTTTATLSMRAGVAFLWSEPLLRPLFGIVMIFVGIVGANGSVIMPALFVDAGRQVAELGLFSSMMGAGGLLGIA
IHASVGARISAQNWLAVAFCGSAVGSLLLSQLPGVPVLMLLGALVGLLTGSVSPILNAAIYNRTPPELLGRVLGTVSAVMLSASPMVMLA
AGAFVDLAGPLPGLVVSAVFAGLVALLSLRLQFATMAAAATASAPTHTEGEH

>gb|AY522923.1|-|7745-8983|Mrx [Aeromonas hydrophila]
ATGAGCGAACGTCGATATAGCCCGCTCGCGACGCTGTTCGCGGCGACCTTTCTCTTCCGGATCGGCAACGCGGTGGCGGCCCTCGCGCTT
CCATGGTTCGTCCTGTCTCATACAAAGAGCGCGGCCTGGGCGGGCGCCACGGCCGCTAGCAGCGTCATCGCGACCATCATCGGCGCGTGG
GTTGGTGGTGGCCTCGTCGATCGGTTCGGGCGCGCGCCCGTCGCATTGATCTCGGGTGTGGTGGGCGGCGTGGCCATGGCGAGCATCCCA
CTGCTCGATGCCGTTGGCGCCCTCTCGAACACTGGGCTGATCGCTTGCGTGGTGCTCGGTGCCGCGTTCGACGCACCCGGTATGGCCGCG
CAGGACAGTGAGCTGCCCAAACTCGGCCACGTCGCCGGGCTCTCCGTTGAGCGCGTCTCGTCACTGAAAGCGGTGATCGGGAACGTCGCG
ATTCTAGGTGGCCCGGCCCTTGGGGGGGCCGCAATCGGCCTGCTTGGCGCTGCGCCAACGCTCGGGCTGACGGCGTTCTGCTCCGTCCTT
GCAGGTCTGCTCGGCGCGTGGGTGCTTCCCGCGCGTGCCGCTCGGACGATGACCACGACGGCGACTCTCTCCATGCGCGCCGGCGTCGCT
TTTCTCTGGAGCGAACCCCTGCTGCGCCCTCTCTTTGGTATAGTGATGATCTTCGTGGGCATCGTTGGCGCCAACGGCAGCGTCATCATG
CCTGCGCTGTTTGTAGATGCAGGACGCCAAGTAGCAGAGCTCGGGCTGTTCTCCTCAATGATGGGGGCTGGTGGTCTCCTTGGCATTGCC
ATTCATGCGTCGGTCGGCGCCCGGATATCAGCGCAGAACTGGCTGGCGGTGGCATTTTGTGGCTCTGCGGTGGGCTCGCTTCTGCTTTCA
CAGTTGCCAGGCGTGCCGGTGCTGATGTTGTTGGGCGCGCTCGTGGGACTGCTGACCGGCTCAGTCTCTCCCATTCTCAACGCTGCCATC
TACAACCGCACGCCGCCAGAACTTCTCGGCCGGGTACTCGGCACGGTCTCGGCGGTGATGCTGTCAGCCTCGCCCATGGTTATGCTTGCG
GCCGGCGCGTTTGTCGACCTTGCTGGTCCGCTCCCTGGCCTCGTTGTATCGGCCGTGTTTGCGGGGCTCGTGGCTCTACTCTCGCTCCGT
CTTCAATTTGCTACAATGGCGGCGGCAGCCACAGCCTCCGCCCCAACCCATACAGAAGGTGAACACTGA

Mrx

Prevalence: protein homolog model (view sequences)

Graph