PmpM

Accession ARO:3004077
Synonym(s)PA1361
DefinitionPmpM is a multidrug efflux pump belonging to the MATE family of Pseudomonas aeruginosa. PmpM is an H+ drug antiporter and is the first reported case of an H+ coupled efflux pump in the MATE family. PmpM confers resistance to fluoroquinolones, fradiomycin, benzalkonium chloride, chlorhexidine gluconate, ethidium bromide, tetraphenylphosphonium chloride (TPPCl), and rhodamine 6G.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classtetracycline antibiotic, aminoglycoside antibiotic, acridine dye, glycylcycline, fluoroquinolone antibiotic, benzalkonium chloride
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification12 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ confers_resistance_to_antibiotic neomycin [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
+ confers_resistance_to_drug_class benzalkonium chloride [Drug Class]
Publications

He GX, et al. 2004. J. Bacteriol. 186(1):262-5 An H(+)-coupled multidrug efflux pump, PmpM, a member of the MATE family of transporters, from Pseudomonas aeruginosa. (PMID 14679249)

Resistomes

Prevalence of PmpM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 900


>gb|AAG04750.1|-|PmpM [Pseudomonas aeruginosa PAO1]
MNSPALPLSRGLRIRAELKELLTLAAPIMIAQLATTAMGFVDAVMAGRASPHDLAAVALGNSIWIPMFLLMTGTLLATTAKVAQRHGAGD
QPGTGPLVRQALWLALLIGPLSGAVLWWLSEPILGLMKVRPELIGPSLLYLKGIALGFPAAALYHVLRCYTNGLGRTRPSMVLGIGGLLL
NIPINYALIYGHFGMPKMGGPGCGWATGSVMWFMFLGMLFWVNKASIYRASQLFSRWEWPDRATIGPLVAVGLPIGIAVFAESSIFSVIA
LLIGGLDENVVAGHQIALNFSALVFMIPYSLGMAVTVRVGHNLGAGLPRDARFAAGVGMAAALGYACVSASLMLLLREQIAAMYSPDPAV
IAIAASLIVFSALFQFSDALQVTAAGALRGYQDTRVTMIMTLFAYWGIGLPVGYSLGLTDWFQEPTGPRGLWQGLVVGLTGAAIMLCIRL
ARSARRFIRQHERLQREDAEAASVLGR


>gb|AE004091.2|-|1472547-1473980|PmpM [Pseudomonas aeruginosa PAO1]
GTGAACAGCCCCGCCCTGCCCCTTTCCCGTGGCTTGCGCATCCGCGCCGAACTCAAGGAACTGCTGACCCTCGCCGCGCCGATCATGATC
GCGCAACTGGCGACCACCGCCATGGGCTTCGTCGATGCGGTGATGGCCGGGCGCGCCAGTCCGCACGACCTGGCAGCGGTGGCGCTGGGC
AACTCCATCTGGATCCCGATGTTCCTGCTGATGACCGGCACCCTGCTCGCCACCACGGCCAAGGTCGCCCAGCGCCATGGCGCCGGCGAC
CAGCCCGGCACCGGGCCGCTGGTGCGCCAGGCGCTGTGGCTGGCGCTGCTGATCGGACCGCTGTCGGGGGCGGTGCTGTGGTGGTTGTCG
GAGCCGATCCTCGGCTTGATGAAAGTGCGCCCGGAACTGATCGGGCCGAGCCTGCTGTACCTCAAGGGCATCGCCCTGGGCTTCCCGGCG
GCGGCGCTGTACCACGTACTGCGCTGCTACACCAACGGCCTGGGACGGACCCGGCCGAGCATGGTGCTGGGGATCGGCGGGCTGCTGCTG
AACATCCCGATCAACTACGCGCTGATCTACGGCCACTTCGGCATGCCGAAGATGGGTGGCCCCGGCTGCGGCTGGGCCACCGGCTCGGTG
ATGTGGTTCATGTTCCTCGGCATGCTGTTCTGGGTGAACAAGGCCTCGATCTACCGCGCCAGCCAGTTGTTCTCGCGCTGGGAGTGGCCG
GATCGCGCGACCATCGGCCCGCTGGTGGCGGTCGGCCTGCCGATCGGCATCGCGGTGTTCGCCGAGTCGAGCATCTTCTCGGTGATCGCC
CTGCTGATCGGCGGGCTCGACGAGAACGTGGTGGCCGGCCACCAGATCGCCCTGAACTTCAGCGCGCTGGTGTTCATGATTCCCTATTCG
CTGGGGATGGCGGTGACCGTGCGGGTCGGCCACAACCTCGGCGCCGGCCTGCCGCGCGACGCGCGCTTCGCCGCCGGCGTGGGGATGGCC
GCGGCGCTGGGCTACGCCTGCGTCTCGGCGAGCCTGATGTTGTTGCTGCGCGAGCAGATCGCCGCGATGTATTCGCCGGACCCGGCGGTG
ATCGCCATCGCCGCCTCGCTGATCGTGTTCTCCGCGCTGTTCCAGTTCTCCGACGCCCTGCAGGTCACCGCCGCCGGGGCCCTGCGCGGC
TACCAGGACACCCGGGTGACGATGATCATGACCCTGTTCGCCTACTGGGGCATCGGCCTGCCGGTGGGCTACAGCCTCGGCCTCACCGAC
TGGTTCCAGGAACCCACCGGACCGCGCGGTCTGTGGCAAGGCCTGGTGGTGGGCCTGACCGGCGCGGCGATCATGCTCTGCATCCGCCTG
GCGCGCAGCGCGCGGCGCTTCATCCGCCAGCACGAGCGCCTGCAGCGGGAGGACGCGGAGGCCGCCTCAGTCCTTGGCCGGTAG