QepA2

Accession ARO:3004103
CARD Short NameQepA2
DefinitionQepA2 is a plasmid-mediated quinolone resistance pump found in an Escherichia coli isolate from France.
AMR Gene Familymajor facilitator superfamily (MFS) antibiotic efflux pump
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesKlebsiella pneumoniaewgs
Resistomes with Sequence VariantsCitrobacter freundiiwgs, Citrobacter portucalensisp, Enterobacter cloacaewgs, Escherichia colig+p+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep, Morganella morganiig+p+wgs, Salmonella entericap+wgs, Shigella flexneriwgs, Vibrio choleraewgs
Classification7 ontology terms | Show
Parent Term(s)4 ontology terms | Show
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic moxifloxacin [Antibiotic]
+ major facilitator superfamily (MFS) antibiotic efflux pump [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
Publications

Cattoir V, et al. 2008. Antimicrob. Agents Chemother. 52(10):3801-4 Plasmid-mediated quinolone resistance pump QepA2 in an Escherichia coli isolate from France. (PMID 18644958)

Resistomes

Prevalence of QepA2 among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Citrobacter freundii0%0%0.48%0%
Citrobacter portucalensis0%1.52%0%0%
Enterobacter cloacae0%0%0.72%0%
Escherichia coli0.13%0.05%0.35%0%
Klebsiella pneumoniae0%0.01%0.13%0%
Klebsiella quasipneumoniae0%0.27%0%0%
Morganella morganii2%2.7%0.69%0%
Salmonella enterica0%0.41%0.06%0%
Shigella flexneri0%0%0.32%0%
Vibrio cholerae0%0%0.07%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|ACF70723.1|+|QepA2 [Escherichia coli]
MSATLHDTAADRRKATRREWIGLAVVALPCLVYAMDLTVLNLALPVLSRELQPSSAQLLWILDIYGFFVAGFLITMGTLGDRIGRRRLLL
IGAAFFAFGSVLAALADTAALLIAARALLGLAGATIAPSTMALIRNMFHDPRQRQFAIGVWIAAFSLGSAIGPLVGGVLLEFFHWGAVFW
LNVPVMLLTLALGPRFLPEYRDPDAGHLDLASVLLSLAAVLLTIYGLKQLAEHGAGLASMAALLAGLAVGALFLRRQGHIAYPLLDLRLF
AHAPFRAALAAYALAALAMFGVYIFMTQYLQLVLGLSPLQAGLATLPWSLCFVIGSLLSPQLAARWPAARILVVGLSAAAFGFAVLGLGQ
GLWWLVPATIVMGLGLAPVFTIGNEIIITSAPSERAGAASALSETVSEFSGALGIALFGSVGLVVYRQALTSAALPGLPADALQAAGASL
GGAVHLADTLPAWQGAALLAAARAGFTDALQATAWAGAVLVLVAAGLVARLLRKRPALASG


>gb|EU847537.1|+|1672-3207|QepA2 [Escherichia coli]
ATGTCCGCCACGCTCCACGACACCGCAGCGGATCGTCGGAAGGCCACCCGCCGCGAATGGATCGGCCTGGCCGTGGTCGCCCTGCCGTGC
CTGGTCTACGCCATGGACCTCACGGTGCTGAACCTGGCGCTGCCGGTGCTCAGCCGTGAACTGCAGCCCTCCAGCGCCCAGCTTCTCTGG
ATCCTGGACATCTACGGCTTCTTCGTCGCCGGCTTCCTGATCACCATGGGCACGCTGGGCGACCGCATCGGCCGGCGCCGGCTGTTGTTG
ATCGGCGCGGCGTTCTTCGCATTCGGCTCGGTGCTCGCGGCGCTGGCCGATACCGCCGCGCTGTTGATCGCGGCGCGCGCCTTGCTCGGC
CTGGCCGGCGCCACCATCGCGCCGTCCACCATGGCGCTGATCCGCAACATGTTCCACGACCCGCGCCAGCGCCAGTTCGCCATCGGCGTG
TGGATCGCCGCGTTTTCGCTGGGCAGCGCGATCGGTCCGCTGGTCGGCGGCGTGTTGCTGGAGTTCTTCCACTGGGGCGCCGTGTTCTGG
CTCAACGTGCCGGTGATGCTGCTGACGCTGGCGCTCGGCCCTCGCTTCCTGCCCGAGTATCGTGATCCGGACGCGGGGCACCTGGACCTG
GCCAGCGTGCTGCTGTCGCTGGCGGCGGTGCTGCTGACGATCTACGGGCTCAAGCAGTTGGCCGAGCATGGAGCGGGCCTCGCCTCGATG
GCTGCGCTGCTGGCCGGGCTGGCGGTCGGGGCGCTGTTCCTGCGCCGCCAGGGCCACATCGCCTACCCGCTGCTGGACCTGCGGCTGTTC
GCGCACGCGCCGTTCCGCGCGGCGCTGGCGGCGTATGCGCTGGCCGCGCTGGCCATGTTCGGCGTCTACATCTTCATGACGCAGTACCTG
CAGCTCGTGCTGGGGCTGTCGCCGCTGCAGGCCGGGCTGGCCACGCTGCCCTGGTCCCTGTGCTTCGTCATCGGTTCGCTGTTGTCGCCG
CAGCTCGCGGCGCGCTGGCCGGCGGCGCGCATCCTCGTCGTGGGCCTGTCGGCAGCGGCGTTCGGCTTCGCCGTGCTGGGGCTGGGGCAG
GGCCTGTGGTGGCTGGTGCCGGCCACGATCGTCATGGGCCTGGGCCTGGCGCCGGTGTTCACCATCGGCAACGAGATCATCATCACCAGC
GCGCCGTCCGAGCGCGCGGGCGCGGCCTCGGCCTTGTCGGAGACGGTGTCCGAATTCAGCGGCGCGCTGGGCATCGCGCTGTTCGGCAGC
GTCGGCCTGGTGGTCTACCGGCAGGCGCTGACCAGCGCGGCGCTGCCCGGCCTGCCGGCCGATGCGCTGCAGGCGGCCGGTGCCTCGCTC
GGGGGCGCCGTGCACCTGGCCGACACCCTGCCGGCGTGGCAGGGCGCGGCCTTGCTGGCGGCCGCACGCGCGGGCTTCACCGATGCGCTG
CAGGCCACGGCCTGGGCCGGCGCGGTGCTGGTGCTGGTGGCCGCTGGGCTGGTGGCGCGCCTGCTGCGCAAGCGCCCAGCGCTCGCATCT
GGTTGA