Escherichia coli mipA

Accession ARO:3004127
DefinitionMltA-interacting protein (mipA), is an antibiotic resistance-related outer membrane protein. Deletion of mipA increases kanamycin, nalidixic acid and streptomycin resistance.
AMR Gene FamilyMipA-interacting Protein
Drug Classfluoroquinolone antibiotic, aminoglycoside antibiotic
Resistance Mechanismreduced permeability to antibiotic, resistance by absence
Classification9 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic streptomycin [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic nalidixic acid [Antibiotic]
+ gene conferring resistance via absence
+ MipA-interacting Protein [AMR Gene Family]
Publications

Li H, et al. 2015. FEMS Microbiol. Lett. 362(11): Outer membrane proteomics of kanamycin-resistant Escherichia coli identified MipA as a novel antibiotic resistance-related protein. (PMID 25940639)

Resistomes

Prevalence of Escherichia coli mipA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: An AMR detection model for instances where the absence of a protein - due to large-scale insertion elements, large deletions, or other methods of protein knockout - confers clinical resistance to a known antibiotic. These models include reference sequences. Protein knockout models are currently in development.

Type of Antibiotic Resistance: Intrinsic or chromosomally-encoded


>gb|NP_310518|-|Escherichia coli MipA [Escherichia coli O157:H7 str. Sakai]
MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFWFRGLGGGYYLWNDATDKLSITAYWSPLYFK
AKDSGDHQMRHLDDRKSTMMAGLSYAHFTQYGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKE
SARSGLRGYNSNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPIVDKSWTGLISTGITYKF


>gb|NC_002695.2|-|2467468-2468214|Escherichia coli MipA [Escherichia coli O157:H7 str. Sakai]
GTGACCAAACTCAAACTTCTGGCACTTGGAGTGCTTATCGCAACGTCTGCAGGCGTAGCGCACGCTGAAGGTAAATTTTCCCTGGGCGCA
GGCGTAGGTGTCGTTGAACACCCATATAAAGATTACGATACCGATGTTTACCCAGTACCGGTAATCAACTATGAAGGCGATAACTTCTGG
TTCCGTGGCTTAGGTGGTGGTTACTACCTGTGGAATGACGCAACGGATAAACTTTCAATTACCGCTTACTGGTCGCCGCTTTACTTCAAA
GCTAAAGACAGTGGCGATCACCAAATGCGTCACCTGGATGACCGTAAGAGCACCATGATGGCTGGTCTGTCTTATGCTCACTTTACCCAG
TACGGTTACCTGCGTACCACCCTGGCTGGCGATACCCTGGATAACAGCAACGGCATCGTCTGGGATATGGCCTGGTTGTATCGTTACACC
AACGGTGGCCTGACCGTGACTCCGGGTATTGGTGTGCAGTGGAACAGCGAAAACCAGAACGAATACTATTATGGCGTATCGCGCAAAGAG
TCCGCTCGCAGCGGTCTGCGTGGCTATAACTCGAACGACAGCTGGAGCCCTTACCTGGAGCTGAGCGCCAGCTACAACTTCCTCGGCGAC
TGGAGTGTTTACGGTACCGCGCGCTACACCCGTCTGTCTGATGAAGTTACTGACAGCCCGATTGTGGATAAATCCTGGACTGGCCTGATT
TCTACCGGGATCACCTACAAATTCTGA