mecD

Accession ARO:3004185
DefinitionmecD is a PBP2a variant identified on a genomic resistance island in Macrococcus caseolyticus. MecD confers resistance to methicillin and other beta-lactam antibiotics through the production of an alternative low-affinity PBP. First described by Schwendener et al. 2017 and identified from canine and bovine sources.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesMacrococcus canisg
Resistomes with Sequence VariantsMacrococcus canisg
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic methicillin [Antibiotic]
+ methicillin resistant PBP2 [AMR Gene Family]
Publications

Schwendener S, et al. 2017. Sci Rep 7:43797 Novel methicillin resistance gene mecD in clinical Macrococcus caseolyticus strains from bovine and canine sources. (PMID 28272476)

Resistomes

Prevalence of mecD among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 263 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Macrococcus canis14.29%0%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 1000

Type of Antibiotic Resistance: Acquired


>gb|AQX82857.1|+|mecD [Macrococcus caseolyticus]
MKNIKVKILIVCSLCLISFFLYNLLKENEIDKIFSSIENRNVDEINENITFLSRNTFSKKQRYDRMNHIDNSLGIKKVNITDIKLLEEIV
DTRKYSANMHYDSKFGKFTKKGYFEFEKNGESKRWELNWTPEVIIPGLTATNEVRVEELKSSRGEIVDRNGIPLAIDGEHYQVGIDPKNY
NKKDSKQIAKLLNINESTLKNKLKQSWVKDGVFVPIKSYVELSDEIKNKIPEYGLSVNKIKGRTYPLKEASAHLLGYIGEINADELNDPK
FKGYDSHSIVGKTGIEYMYDKELQNRDGLIVYITDDDGLTDSKEILVHKKPKNGKKIVLSIDSRVQNSIYNHLKDDNGSGTAMNPKTGEL
LALVSYPSFNPYDFMFGISNKKYQALLNDKKAPLLNKFQELTSPGSTQKLLTSIIGLNNGVINESKSYEINGKGWRKDGSWGGYKVTRFE
VVNGRIDLEKAIAHSDNIFFARTTLEMGGKKFVRGMKDLGVGEETPSDYPVRTGQIANKINLERNLNNDILLADSGYGQGEILVNPIHIL
SIYSSLVNEGNMMAPKLNMEHKSKVWKKHITSQKNIDILTSSMRKVVTGTHKLDTERNYANFAGKTGTAELKMTQNEGLGTQIGWFVGYD
QQNPNMMLAINVKNVEDKGMSSYNAQKFAQVMDDLYEHGARTYEPDSE


>gb|KY013611.1|+|15438-17474|mecD [Macrococcus caseolyticus]
ATGAAGAATATAAAAGTTAAAATATTAATAGTTTGTAGCCTATGTCTTATATCATTTTTCTTATATAATTTATTGAAAGAAAATGAAATT
GATAAAATATTTTCTTCAATTGAAAATCGAAATGTAGATGAAATAAATGAGAATATTACTTTTTTATCAAGAAATACTTTTAGTAAAAAA
CAAAGATACGATAGAATGAATCATATTGATAATTCTCTAGGCATAAAAAAAGTAAATATAACTGATATAAAGTTATTAGAAGAAATTGTA
GACACTCGAAAATATAGTGCTAATATGCACTATGATTCTAAATTCGGTAAATTCACAAAAAAAGGTTATTTTGAGTTTGAAAAAAATGGT
GAGAGTAAACGTTGGGAATTGAACTGGACACCAGAGGTTATAATTCCAGGACTTACAGCAACTAATGAAGTACGAGTAGAAGAATTGAAA
TCAAGTAGAGGTGAAATTGTAGATAGAAATGGAATTCCTTTAGCGATAGATGGTGAACATTATCAGGTAGGAATTGATCCTAAAAATTAT
AATAAGAAGGATAGTAAACAAATAGCTAAGTTATTAAATATAAATGAGAGTACTTTAAAGAACAAATTAAAACAATCATGGGTTAAAGAT
GGAGTATTTGTTCCAATCAAATCATATGTAGAATTAAGTGATGAAATTAAAAATAAAATACCTGAATACGGATTATCTGTGAATAAAATA
AAAGGTAGAACTTACCCATTAAAAGAAGCAAGTGCTCATTTGTTAGGTTATATTGGTGAAATAAATGCAGATGAGCTTAATGATCCAAAA
TTTAAAGGATATGATTCTCATTCAATTGTTGGTAAAACTGGTATTGAATATATGTACGATAAAGAATTACAAAACAGAGATGGTTTAATA
GTATATATTACTGATGATGATGGTTTAACAGATTCAAAAGAAATATTAGTTCATAAGAAACCTAAAAATGGAAAAAAGATAGTTTTATCG
ATAGATAGTAGAGTTCAAAATAGTATTTACAATCATTTAAAAGATGATAATGGATCTGGTACTGCTATGAATCCCAAAACAGGAGAATTA
TTAGCTTTAGTAAGCTATCCATCATTTAATCCTTATGATTTTATGTTTGGTATTTCAAATAAAAAATATCAGGCCTTATTAAATGATAAA
AAGGCTCCGCTTTTAAATAAATTTCAAGAATTAACTTCTCCAGGTTCTACTCAAAAATTGCTAACTTCTATAATAGGTTTAAATAATGGG
GTTATAAATGAAAGCAAAAGTTATGAAATAAATGGTAAAGGATGGAGAAAAGATGGGAGCTGGGGAGGATATAAAGTAACAAGATTTGAA
GTTGTCAATGGACGAATTGATTTAGAGAAAGCTATAGCACATTCAGACAATATCTTTTTTGCTAGAACAACCCTAGAAATGGGTGGGAAA
AAATTTGTAAGGGGAATGAAGGATTTAGGTGTAGGAGAGGAAACGCCTTCTGATTACCCTGTTCGGACTGGCCAAATAGCGAATAAAATT
AATCTAGAAAGAAATTTGAATAATGATATATTGTTAGCAGACTCAGGTTATGGACAAGGTGAAATATTGGTGAATCCAATTCATATTTTA
TCTATATATAGTTCATTAGTAAATGAAGGGAATATGATGGCACCTAAATTAAATATGGAACATAAAAGCAAAGTATGGAAAAAACATATT
ACATCACAAAAAAATATTGATATATTAACAAGTAGTATGAGAAAAGTTGTTACAGGCACTCATAAATTAGATACCGAAAGAAATTATGCT
AACTTTGCTGGAAAAACTGGTACAGCAGAATTAAAAATGACTCAGAATGAAGGATTAGGTACACAAATTGGATGGTTTGTGGGTTATGAT
CAACAAAATCCAAATATGATGTTAGCTATAAATGTTAAAAATGTTGAAGACAAAGGTATGTCTAGCTATAATGCACAAAAATTTGCGCAA
GTAATGGATGATTTATATGAACATGGAGCTAGGACTTATGAACCAGACTCAGAATAA