Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin

Accession ARO:3004630
DefinitionMycoplasma genitalium exhibits multiple mutations in parC which confers resistance to Moxifloxacin.
AMR Gene Familyfluoroquinolone resistant parC
Drug Classfluoroquinolone antibiotic
Resistance Mechanismantibiotic target alteration
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ fluoroquinolone resistant parC [AMR Gene Family]
Publications

Shimada Y, et al. 2010. Int. J. Antimicrob. Agents 36(3):255-8 Emergence of clinical strains of Mycoplasma genitalium harbouring alterations in ParC associated with fluoroquinolone resistance. (PMID 20580532)

Gruson D, et al. 2005. Antimicrob Agents Chemother 49(3): 1190-1193. In vitro development of resistance to six and four fluoroquinolones in Mycoplasma pneumoniae and Mycoplasma hominis, respectively. (PMID 15728924)

Beeton ML, et al. 2009. J. Antimicrob. Chemother. 64(3):529-38 Comparison of full gyrA, gyrB, parC and parE gene sequences between all Ureaplasma parvum and Ureaplasma urealyticum serovars to separate true fluoroquinolone antibiotic resistance mutations from non-resistance polymorphism. (PMID 19567408)

Tagg KA, et al. 2013. J. Clin. Microbiol. 51(7):2245-9 Fluoroquinolone and macrolide resistance-associated mutations in Mycoplasma genitalium. (PMID 23658265)

Hamasuna R, et al. 2018. PLoS ONE 13(6):e0198355 Mutations in ParC and GyrA of moxifloxacin-resistant and susceptible Mycoplasma genitalium strains. (PMID 29883482)

Resistomes

Prevalence of Mycoplasma genitalium parC mutations confers resistance to Moxifloxacin among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein variant model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
No prevalence data


Detection Models

Model Type: protein variant model

Model Definition: The protein variant model is an AMR detection model. Protein variant models are similar to protein homolog models - they detect the presence of a protein sequence based on its similarity to a curated reference sequence, but secondarily search submitted query sequences for curated sets of mutations shown clinically to confer resistance relative to wild-type. This model includes a protein reference sequence, a curated BLASTP cut-off, and mapped resistance variants. Mapped resistance variants may include any or all of: single resistance variants, insertions, deletions, co-dependent resistance variants, nonsense SNPs, and/or frameshift mutations. Protein variant model matches to reference sequences are categorized on two criteria: strict and loose. A strict match has a BLASTP bitscore above the curated BLASTP cutoff value and contains at least one detected mutation from amongst the mapped resistance variants; a loose match has a BLASTP bitscore below the curated BLASTP cutoff value but still contains at least one detected mutation from amongst the mapped resistance variants. Regardless of BLASTP bitscore, if a sequence does not contain one of the mapped resistance variants, it is not considered a match and not detected by the protein variant model.

Legend:

  • discovered in clinical, agricultural, or environmental isolates
  • discovered via laboratory selection experiments


Bit-score Cut-off (blastP): 1200

PMID: 20580532S83R D87Y D87H
PMID: 15728924G81C S83I D87G D87N
PMID: 19567408D82N
PMID: 23658265V103I
PMID: 29883482P62S A66T A67S S83N A119V

>gb|AAC71422.1|+|Mycoplasma Genitalium ParC mutations confers resistance to Moxifloxacin [Mycoplasma genitalium G37]
MDQKNNNLFQKAIEEVFAVSFSKYAKYIIQDRALPDLRDGLKPVQRRILYGMFQMGLKPT
TPYKKSARAVGEIMGKYHPHGDSSIYDAIIRMSQSWKNNWTTVSIHGNNGSVDGDNAAAM
RYTETRLSLYGFELLKDIDKKLVSFINNFDDSEKEPTVLPTLLPNLFINGASGIAAGYAT
NIAPHNTNELLDSLCLRIDQPNCELKQILKIVKGPDFPTGGNVYFEKSLSDIYQAGKGKF
IIQAKYEVNKNLNQIEITQIPYETLKANIVKQIEEIIFDNKLSAIESVIDSSDRNGIRII
IKHKDFLPAEKIMAFLFKHTQLQVNFNLNNTVIANRFPIQIGLLSYLDHFLKFCHELIIN
KAKYELELASKRLEIILGLIKAISIIDKIIKLIRSAVDKSDAREKLIDNFKFTFNQAEAI
VSLRLYQLTNTDIFELNQEQNELEKTVISSEQLIASEKARNKLLKKQFEGYKKQFHQQRR
SQICGFINQKKVEESELIENKTYGVLITKAGNYHKFESNQLLKSTTDFKSESDTIIFAQT
IANTDQIFIVTSLGNIINIPVYKLAFNSKNKLASLVSKKPILLEYETIVFVGTMNSVNQP
ILVLTSKLGMVKRIDLTKLNIKPLKATLCISLRDKDHLVSAFLQQDDKLICLVSDHNYYT
VFHTNEIPLISSKGMGVKGMKLKLEDQIKFVVAFEANEPLVMICSDGSVINLKQTELVVV
SRMATAKKLPVKKAINYCFSDATNTQLINFQGKNGSKLITTSELNQMSKTAISQTRFNKL
N



>gb|L43967.2|+|242224-244569|Mycoplasma Genitalium ParC mutations confers resistance to Moxifloxacin [Mycoplasma genitalium G37]
ATGGATCAAAAAAACAACAACCTCTTTCAAAAGGCAATTGAAGAAGTCTTTGCAGTTAGCTTTAGTAAGTATGCTAAATACATCATCCAA
GATAGAGCTTTACCTGATCTAAGAGATGGGTTAAAACCAGTACAAAGACGGATCTTATATGGGATGTTTCAAATGGGCTTAAAACCCACC
ACTCCCTATAAAAAATCAGCCCGTGCTGTTGGGGAGATCATGGGGAAATACCACCCCCATGGTGATAGTTCCATTTATGATGCAATTATC
AGAATGTCCCAAAGCTGAAAGAACAACTGAACAACTGTTTCTATCCATGGTAACAATGGTTCAGTGGATGGGGATAATGCTGCAGCAATG
CGTTACACAGAAACCCGCTTAAGCTTGTATGGATTTGAACTATTAAAAGACATTGATAAAAAGTTAGTTAGTTTTATCAATAACTTTGAT
GATAGTGAAAAAGAACCAACGGTTTTACCAACCTTACTGCCTAACCTCTTTATCAATGGTGCGAGTGGGATAGCTGCTGGATATGCAACT
AATATTGCTCCCCATAACACTAATGAACTATTAGATAGTCTTTGCTTGCGAATAGACCAACCTAATTGTGAACTTAAACAAATTTTAAAA
ATTGTTAAAGGTCCTGATTTTCCAACAGGGGGTAATGTTTATTTTGAAAAGAGTTTAAGTGATATTTATCAAGCAGGCAAAGGTAAATTT
ATTATCCAAGCTAAGTATGAAGTTAACAAGAACTTAAACCAGATTGAAATTACCCAAATCCCTTATGAAACACTGAAAGCTAACATTGTC
AAACAAATTGAAGAGATTATCTTTGACAATAAACTATCTGCTATTGAAAGTGTCATTGATAGTTCAGATCGCAACGGCATTAGGATCATT
ATTAAACACAAGGACTTTTTGCCTGCTGAGAAGATCATGGCCTTTTTGTTTAAACACACCCAACTCCAAGTGAACTTTAACCTTAATAAC
ACCGTGATTGCTAACCGCTTTCCCATCCAAATTGGTTTACTAAGTTACCTCGATCATTTTTTAAAGTTTTGTCATGAACTAATTATTAAT
AAAGCTAAGTATGAACTTGAGCTTGCAAGCAAGCGCTTGGAAATTATTTTAGGACTAATTAAAGCGATTAGTATCATTGATAAAATCATC
AAATTAATTAGATCAGCAGTTGACAAAAGTGATGCAAGAGAAAAGTTAATTGATAACTTTAAATTTACTTTTAACCAAGCAGAGGCAATT
GTTAGTTTGCGACTTTACCAACTAACTAACACTGATATTTTTGAACTTAACCAAGAACAAAATGAACTTGAAAAAACTGTGATTAGTTCA
GAGCAACTAATTGCTAGTGAAAAAGCAAGAAACAAACTCCTAAAAAAACAGTTTGAAGGTTATAAAAAGCAGTTTCACCAGCAACGAAGG
TCACAAATATGTGGCTTTATTAACCAAAAAAAGGTGGAGGAAAGTGAGCTAATTGAAAACAAAACTTATGGGGTTTTAATCACTAAAGCT
GGTAACTACCATAAGTTTGAATCTAACCAACTATTAAAAAGCACCACTGATTTTAAAAGTGAGAGTGACACAATTATCTTTGCACAAACT
ATTGCTAATACCGACCAAATTTTTATTGTCACTTCACTAGGTAACATTATTAATATCCCTGTTTATAAATTAGCTTTCAATTCCAAAAAT
AAACTAGCAAGTTTAGTTAGTAAAAAACCAATCCTTTTGGAGTATGAAACGATTGTTTTTGTTGGAACAATGAACAGTGTAAACCAACCA
ATCCTTGTTTTAACTTCCAAACTAGGAATGGTTAAACGGATTGATTTAACCAAACTTAACATTAAGCCACTTAAAGCTACTTTGTGTATC
TCACTCCGTGATAAAGACCATTTAGTAAGTGCATTTTTACAACAAGATGATAAACTGATCTGTTTAGTGTCTGATCACAACTATTACACT
GTTTTTCACACCAATGAGATCCCATTAATTAGTAGTAAGGGGATGGGAGTGAAGGGGATGAAGTTAAAACTAGAGGATCAAATTAAGTTT
GTTGTTGCTTTTGAAGCTAATGAACCGTTAGTGATGATATGTAGTGATGGTAGTGTCATTAACTTAAAACAAACTGAACTAGTTGTAGTT
AGCAGGATGGCAACTGCAAAAAAACTGCCTGTTAAGAAAGCAATTAACTATTGTTTTAGTGATGCAACTAACACCCAGTTAATTAATTTT
CAGGGTAAGAACGGTAGTAAATTAATTACAACTAGTGAACTGAACCAGATGAGTAAAACTGCAATTAGTCAAACCAGGTTTAACAAACTT
AATTAG