Tet(X3)

Accession ARO:3004719
DefinitionA tetracyline resistance gene located on an approximately 300-kb plasmid, designated p47AB. It inactivates all tetracyclines, including tigecycline, eravacycline, and omadacycline.Adjacent to insertion sequence ISVsa3 on the conjugative plasmid.
AMR Gene Familytetracycline inactivation enzyme
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic inactivation
ResistomesAcinetobacter baumanniiwgs, Acinetobacter nosocomialisp+wgs
Classification10 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ tetracycline inactivation enzyme [AMR Gene Family]
Publications

He T, et al. 2019. Nat Microbiol : Emergence of plasmid-mediated high-level tigecycline resistance genes in animals and humans. (PMID 31133751)

Resistomes

Prevalence of Tet(X3) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 82 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Acinetobacter baumannii0%0%0.11%
Acinetobacter nosocomialis0%2%2%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 760


>gb|QBQ85438.1|+|Tet(X3) [Acinetobacter baumannii]
MTMRIDTDKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVN
IADEKGNILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVILANGGMSKIRSFVTD
TQVEETGTFNIQADILQPEINCPGFFQLCNGNRLMAGHQGILLFANPNNNGALYLGISFKTPDEWKNKIPLDFQDRNSVADFLLKRFSKW
SEVYKQLIRSVSTFQCLPTRKFPLNNDWKSNRPLPITMIGDAAHLMSPFAGQGVNTGLLDALILSENLTNGEFTSIENAIENYEQQMFVY
AKDTQDESTENETEMFSPNFSFQKLLNL


>gb|MK134375.1|+|6174-7340|Tet(X3) [Acinetobacter baumannii]
ATGACAATGCGAATAGATACAGACAAACAAATGAATTTACTTAGTGATAAGAACGTTGCAATAATTGGTGGTGGACCCGTTGGACTGACT
ATGGCAAAATTATTACAGCAAAACGGCATAGACGTTTCAGTTTACGAAAGAGACAACGACCGAGAGGCAAGAATTTTTGGTGGAACCCTT
GACCTACACAAAGGTTCAGGTCAGGAAGCAATGAAAAAAGCGGGATTGTTACAAACTTATTATGACTTAGCCTTACCAATGGGTGTAAAT
ATTGCTGATGAAAAAGGCAATATTTTATCCACAAAAAATGTAAAGCCCGAAAATCGATTTGACAATCCTGAAATAAACAGAAATGACTTA
AGGGCTATCTTGTTGAATAGTTTAGAAAACGACACGGTTATTTGGGATAGAAAACTTGTTATGCTTGAACCTGGTAAGAAGAAGTGGACA
CTAACTTTTGAGAATAAACCGAGTGAAACAGCAGATTTGGTTATTCTTGCCAATGGTGGAATGTCGAAAATAAGGAGCTTTGTTACCGAC
ACGCAAGTTGAAGAAACCGGTACTTTCAACATCCAAGCTGATATTCTTCAACCGGAAATAAACTGTCCCGGATTTTTTCAGCTATGCAAC
GGCAACCGATTAATGGCGGGACATCAGGGCATTTTATTGTTTGCCAATCCCAATAATAATGGTGCATTGTATTTAGGAATTAGTTTTAAA
ACGCCCGATGAATGGAAAAATAAAATTCCCTTAGATTTTCAGGACAGAAACAGCGTTGCCGATTTTTTATTGAAAAGATTTTCCAAATGG
AGTGAAGTTTACAAACAATTAATACGTTCGGTATCAACATTTCAATGCTTGCCCACAAGGAAATTTCCTTTGAACAATGATTGGAAAAGT
AACCGTCCATTACCCATAACAATGATTGGCGATGCTGCTCATTTGATGTCGCCTTTTGCAGGACAGGGTGTAAATACGGGATTATTGGAT
GCTTTGATATTGTCTGAAAACCTTACAAACGGAGAATTTACAAGTATTGAAAATGCCATCGAAAACTACGAACAACAAATGTTTGTTTAT
GCAAAAGATACGCAGGACGAATCGACAGAAAACGAAACCGAAATGTTTAGTCCCAATTTTTCGTTTCAAAAATTATTGAATCTATAA