tet(X4)

Accession ARO:3004720
Synonym(s)tetX4
CARD Short Nametet(X4)
DefinitionA tetracyline resistance gene located on an approximately 180-kb plasmid, designated p47EC. It inactivates all tetracyclines, including tigecycline, eravacycline, and omadacycline.Adjacent to insertion sequence ISVsa3 on the conjugative plasmid.
AMR Gene Familytetracycline inactivation enzyme
Drug Classtetracycline antibiotic, glycylcycline
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAcinetobacter indicusg+wgs, Acinetobacter townerig, Aeromonas caviaeg, Aeromonas hydrophilag, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniip, Enterobacter cloacaep, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiiwgs, Proteus mirabiliswgs, Proteus vulgariswgs, Salmonella entericap+wgs, Shigella flexneriwgs
Resistomes with Sequence VariantsAcinetobacter indicusg+wgs, Acinetobacter townerig, Aeromonas caviaeg, Aeromonas hydrophilag, Bacteroides ovatuswgs, Bacteroides thetaiotaomicronwgs, Citrobacter freundiip+wgs, Citrobacter portucalensiswgs, Citrobacter werkmaniip, Enterobacter cloacaep, Enterobacter hormaecheip+wgs, Escherichia colip+wgs, Escherichia fergusoniip+wgs, Klebsiella aerogenesp+wgs, Klebsiella michiganensisp+wgs, Klebsiella pneumoniaep+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiiwgs, Myroides phaeusg, Proteus mirabilisp+wgs, Proteus vulgariswgs, Riemerella anatipestiferg+p+wgs, Salmonella entericap+wgs, Shigella flexneriwgs
Classification9 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic tigecycline [Antibiotic]
+ confers_resistance_to_antibiotic tetracycline [Antibiotic]
+ tetracycline inactivation enzyme [AMR Gene Family]
Publications

He T, et al. 2019. Nat Microbiol : Emergence of plasmid-mediated high-level tigecycline resistance genes in animals and humans. (PMID 31133751)

Resistomes

Prevalence of tet(X4) among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter indicus14.29%0%2.6%0%
Acinetobacter towneri12.5%0%0%0%
Aeromonas caviae2.27%0%0%0%
Aeromonas hydrophila1.54%0%0%0%
Bacteroides ovatus0%0%0.38%0%
Bacteroides thetaiotaomicron0%0%0.35%0%
Citrobacter freundii0%0.31%0.97%0%
Citrobacter portucalensis0%0%1.8%0%
Citrobacter werkmanii0%10%0%0%
Enterobacter cloacae0%0.56%0%0%
Enterobacter hormaechei0%0.06%0.13%0%
Escherichia coli0%0.47%0.28%0%
Escherichia fergusonii0%0.71%3.26%0%
Klebsiella aerogenes0%2.17%0.28%0%
Klebsiella michiganensis0%0.57%0.27%0%
Klebsiella pneumoniae0%0.07%0.06%0%
Klebsiella quasipneumoniae0%0.21%0.53%0%
Morganella morganii0%0%1.23%0%
Myroides phaeus100%0%0%0%
Proteus mirabilis0%1.25%0.17%0%
Proteus vulgaris0%0%5.56%0%
Riemerella anatipestifer86.11%15.38%29.17%0%
Salmonella enterica0%0.05%0.02%0%
Shigella flexneri0%0%0.16%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|QBQ69719.1|-|tet(X4) [Escherichia coli]
MSNKEKQMNLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLDLHKGSGQEAMKKAGLLQTYYDLALPMGVNIAD
EKGNILSTKNVKPENRFDNPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETADLVIIANGGMSKVRKFVTDTEV
EETGTFNIQADIHHPEVNCPGFFQLCNGNRLMAAHQGNLLFANPNNNGALHFGISFKTPDEWKNQTQVDFQNRNSVVDFLLKEFSDWDER
YKELIRVTSSFVGLATRIFPLGKSWKSKRPLPITMIGDAAHLMPPFAGQGVNSGLMDALILSDNLTNGKFNSIEEAIENYEQQMFIYGKE
AQEESTQNEIEMFKPDFTFQQLLNV


>gb|MK134376.1|-|325-1482|tet(X4) [Escherichia coli]
ATGAGCAATAAAGAAAAACAAATGAATTTACTTAGTGATAAGAACGTTGCAATAATTGGTGGTGGACCCGTTGGACTGACTATGGCAAAA
TTATTACAGCAAAACGGCATAGACGTTTCAGTTTACGAAAGAGACAACGACCGAGAGGCAAGAATTTTTGGTGGAACCCTTGACCTACAC
AAAGGTTCAGGTCAGGAAGCAATGAAAAAAGCGGGATTGTTACAAACTTATTATGACTTAGCCTTACCAATGGGTGTAAATATTGCTGAT
GAAAAAGGCAATATTTTATCCACAAAAAATGTAAAGCCCGAAAATCGATTTGACAATCCTGAAATAAACAGAAATGACTTAAGGGCTATC
TTGTTGAATAGTTTAGAAAACGACACGGTTATTTGGGATAGAAAACTTGTTATGCTTGAACCTGGTAAGAAGAAGTGGACACTAACTTTT
GAGAATAAACCGAGTGAAACAGCAGATCTGGTTATTATTGCCAATGGTGGAATGTCTAAAGTAAGAAAATTTGTTACCGACACGGAAGTT
GAAGAAACAGGTACTTTCAATATACAAGCCGATATTCATCATCCAGAGGTGAACTGTCCTGGATTTTTTCAGCTATGCAATGGAAACCGG
CTAATGGCTGCTCATCAAGGTAATTTATTATTTGCGAATCCTAATAATAATGGTGCATTGCATTTTGGAATAAGTTTTAAAACACCTGAT
GAATGGAAAAACCAAACGCAGGTAGATTTTCAAAACAGAAATAGTGTCGTTGATTTTCTTCTGAAAGAATTTTCCGATTGGGACGAACGC
TACAAAGAACTGATTCGTGTGACATCATCTTTTGTAGGGTTAGCGACACGAATATTTCCCTTAGGTAAGTCTTGGAAAAGTAAGCGTCCA
TTACCCATAACGATGATTGGAGATGCTGCTCATTTGATGCCTCCTTTTGCAGGACAAGGCGTAAACAGCGGGTTGATGGATGCCTTGATA
TTGTCGGATAATCTGACCAATGGGAAATTTAACAGCATTGAAGAGGCTATTGAAAATTATGAACAGCAAATGTTTATCTATGGCAAAGAA
GCACAAGAAGAATCAACTCAAAACGAAATTGAAATGTTTAAACCCGACTTTACGTTTCAGCAATTGTTAAATGTATAA