mlaD

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005042
CARD Short NamemlaD
DefinitionmlaD from the mla system is a gene proposed to play a part in the transport of phospholipids to the outer membrane. Insertions in mlaD are shown to confer resistance to linezolid.
AMR Gene FamilyATP-binding cassette (ABC) antibiotic efflux pump
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic, oxazolidinone antibiotic
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Publications

Rundell EA, et al. 2020. J. Bacteriol. 202(6): A Screen for Antibiotic Resistance Determinants Reveals a Fitness Cost of the Flagellum in Pseudomonas aeruginosa. (PMID 31871033)

Resistomes

Prevalence of mlaD among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein knockout model

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
No prevalence data


Detection Models

Model Type: protein knockout model

Model Definition: Protein Knockout Models (PKM) reflect resistance by the absence of a gene product, most often deletion of a gene involved in antibiotic import, such as Vibrio cholerae OmpT. Like Protein Homolog Models (PHMs), PKMs include a reference sequence and a bitscore cut-off for detection using BLASTP but instead are designed to only report lack of detection under Perfect or Strict criteria. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff. This model type is still under development and not currently supported by the Resistance Gene Identifier (RGI) software.

Bit-score Cut-off (blastP): 300


>gb|VWQ04090.1|+|mlaD [Escherichia coli]
MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRY
NHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKDDDNKNSGDAPAAAPGNNETTEPVG
TTK


>gb|LR730402.1|+|3996375-3996926|mlaD [Escherichia coli]
ATGCAAACGAAAAAAAATGAAATTTGGGTGGGTATCTTTTTATTAGCAGCACTGCTTGCGGCGCTGTTTGTTTGCCTGAAGGCAGCGAAC
GTGACGTCTATACGTACTGAACCGACCTATACGCTTTATGCGACGTTCGATAACATTGGCGGCCTGAAAGCCCGCTCTCCGGTCAGCATT
GGTGGCGTTGTTGTGGGCCGGGTGGCGGATATTACGCTGGACCCGAAAACCTATCTGCCGCGCGTAACGCTGGAAATTGAACAACGTTAT
AACCACATTCCTGATACCAGTTCGCTGAGCATTCGTACTTCCGGCCTGCTGGGGGAACAATATCTGGCATTAAACGTCGGTTTTGAAGAC
CCGGAACTGGGGACTGCTATCCTGAAGGATGGCGATACAATTCAGGACACCAAGTCTGCGATGGTGCTGGAAGATCTCATTGGTCAGTTC
CTTTACGGTAGTAAAGACGATGACAATAAGAATAGTGGCGATGCGCCAGCTGCTGCGCCAGGTAATAATGAAACCACTGAACCTGTGGGT
ACAACGAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit