MecC-type methicillin resistance repressor MecI

Accession ARO:3005046
CARD Short NameMecI_rep
DefinitionThis MecI is a methicillin-resistant repressor resembling MecC. It confers resistance to penams.
AMR Gene Familymethicillin resistant PBP2
Drug Classpenam
Resistance Mechanismantibiotic target replacement
Resistomes with Perfect MatchesStaphylococcus aureusg+wgs
Resistomes with Sequence VariantsStaphylococcus aureusg+wgs
Classification12 ontology terms | Show
Parent Term(s)2 ontology terms | Show
+ confers_resistance_to_antibiotic methicillin [Antibiotic]
+ methicillin resistant PBP2 [AMR Gene Family]
Publications

Garcia-Alvarez L, et al. 2011. Lancet Infect Dis 11(8): 595-603. Meticillin-resistant Staphylococcus aureus with a novel mecA homologue in human and bovine populations in the UK and Denmark: a descriptive study. (PMID 21641281)

Resistomes

Prevalence of MecC-type methicillin resistance repressor MecI among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 413 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Staphylococcus aureus0.26%0%0.13%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 200


>gb|CCC86797.1|+|MecC-type methicillin resistance repressor MecI [Staphylococcus aureus subsp. aureus LGA251]
MTREGYDISASEWEIMNTIWNKKLISANDVIEIVQKHKEWSPKTIRTLINRLYKKKFIDRTSRNKIFEYFPIVEEKDMKYKTSKVFLDKV
YEGGLNSLVLNFVENEELSEDDIEELKNILNNKY


>gb|FR821779.1|+|39530-39904|MecC-type methicillin resistance repressor MecI [Staphylococcus aureus subsp. aureus LGA251]
ATGACACGTGAAGGCTATGATATATCAGCGTCAGAATGGGAAATAATGAATACGATTTGGAATAAAAAATTAATAAGTGCTAATGACGTT
ATAGAAATAGTACAAAAGCACAAGGAATGGAGTCCAAAAACAATAAGAACACTAATCAATCGTCTTTACAAAAAGAAATTCATAGATAGA
ACAAGTCGAAATAAAATTTTTGAATATTTCCCAATAGTAGAGGAAAAAGATATGAAGTACAAAACGTCTAAAGTGTTTTTGGATAAAGTG
TATGAAGGTGGATTAAATTCATTAGTCTTAAATTTTGTTGAAAATGAAGAATTGTCCGAAGATGATATTGAAGAATTGAAAAATATATTA
AATAATAAATATTAA