LpsA

Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3005052
CARD Short NameLpsA
DefinitionLpsA plays a role in Lipooligosaccharide biosynthesis. LpsA confers resistance to polymyxin antibiotics.
AMR Gene FamilyIntrinsic peptide antibiotic resistant Lps
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics
Resistance Mechanismreduced permeability to antibiotic
Classification11 ontology terms | Show
Parent Term(s)3 ontology terms | Show
+ confers_resistance_to_antibiotic polymyxin B [Antibiotic]
+ confers_resistance_to_antibiotic defensin [Antibiotic]
+ Intrinsic peptide antibiotic resistant Lps [AMR Gene Family]
Resistomes with Perfect MatchesHaemophilus influenzaeg+wgs
Resistomes with Sequence VariantsHaemophilus influenzaeg+wgs
Publications

El-Sayed Ahmed MAE, et al. 2020. Emerg Microbes Infect 9(1):868-885 Colistin and its role in the Era of antibiotic resistance: an extended review (2000-2019). (PMID 32284036)

Deadman ME, et al. 2006. J. Biol. Chem. 281(40):29455-67 Specific amino acids of the glycosyltransferase LpsA direct the addition of glucose or galactose to the terminal inner core heptose of Haemophilus influenzae lipopolysaccharide via alternative linkages. (PMID 16847057)

Morey P, et al. 2013. Infect Immun 81(11):4100-11 Relative contributions of lipooligosaccharide inner and outer core modifications to nontypeable Haemophilus influenzae pathogenesis. (PMID 23980106)

Resistomes

Prevalence of LpsA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Haemophilus influenzae53.61%0%49.26%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 500


>gb|ABG48543.1|+|LpsA [Haemophilus influenzae]
MHNAAQHNYVISLTTEQKRRKHITEEFGKQNIPFEFFDAITPDIIEETAKKFNITLDRSPKAKLSDGEIGCALSHIVLWDLALENNLNYI
NIFEDDIHLGENAKELLEIDYISDDIHVLKLEANGKMFFKQPKSVKCDRNVYPMTVKQSGCAGYTVTAKGAKYLLELVKNKPLDVAVDSL
VFEDFLHFKDYKIVQLSPGICVQDFVLHPDNPFESSLQEGRDRVHGNQRKFSILEKIKNEFGRVKIKMFGKQVPFK


>gb|DQ647421.1|+|1-771|LpsA [Haemophilus influenzae]
ATGCATAATGCAGCTCAGCACAATTATGTTATCAGTTTAACTACTGAACAAAAACGCCGAAAACATATTACCGAAGAATTCGGTAAGCAG
AATATTCCTTTCGAATTTTTTGATGCTATTACGCCCGACATTATTGAAGAAACCGCTAAAAAATTTAATATTACATTAGATCGCTCTCCT
AAAGCCAAGTTGTCGGATGGGGAAATTGGTTGTGCATTAAGCCATATTGTTTTATGGGATTTAGCATTAGAAAATAATTTAAACTATATC
AATATCTTTGAAGATGATATTCATTTGGGGGAAAATGCCAAAGAATTATTAGAAATTGATTATATTTCTGATGATATTCATGTTTTAAAA
TTAGAAGCAAATGGCAAGATGTTCTTTAAACAACCAAAATCTGTAAAATGCGATAGAAATGTTTATCCCATGACGGTAAAGCAATCAGGA
TGTGCAGGATATACTGTTACAGCAAAAGGGGCTAAATATTTGCTTGAATTAGTAAAAAATAAACCACTTGACGTGGCGGTTGATTCACTT
GTTTTTGAGGATTTTTTACATTTTAAAGATTATAAAATAGTACAACTTTCTCCTGGTATTTGCGTTCAAGATTTTGTGTTACATCCAGAT
AATCCTTTTGAAAGCAGTTTACAAGAAGGACGAGATAGAGTACACGGAAATCAACGCAAGTTCTCTATTTTAGAAAAAATAAAAAATGAA
TTTGGACGAGTAAAAATAAAAATGTTTGGAAAACAAGTTCCATTTAAATAA

Curator Acknowledgements
Curator Description Most Recent Edit