Ontology CARD's Antibiotic Resistance Ontology
Accession ARO:3000010
CARD Short NamevanA
DefinitionVanA is a D-Ala-D-Ala ligase homolog that synthesizes D-Ala-D-Lac, an alternative substrate for peptidoglycan synthesis that reduces vancomycin binding affinity. It has been isolated from VREs. It is associated with both vancomycin and teicoplanin resistance.
AMR Gene FamilyVan ligase, glycopeptide resistance gene cluster
Drug Classpeptide antibiotic, nonribosomal peptide antibiotics, glycopeptide antibiotic
Resistance Mechanismantibiotic target alteration
CARD:Epi text mining of PubMed up to 2021

(top ten associations if supported by more than one publication)
NCBI_TAXONEnterococcus faecium (369), Enterococcus faecalis (162), Enterococcus (65), Staphylococcus aureus (55), Enterococcus gallinarum (17), Enterococcus casseliflavus (11), Enterococcus durans (8), Staphylococcus (6), Escherichia coli (6), Enterobacteriaceae (5)
GAZBrazil (15), Europe (13), [Former] State of Korea (12), Japan (10), Unity State (9), Germany (9), Kingdom of Denmark (8), Australia (7), China (6), Iran (5)
FOODONpoultry drumstick (27), water food product (24), swine (19), chicken (14), meat (skinless) (12), food product for animal (5), turkey (bird) (3), pork meat food product (3), Bos taurus (3), cheese food product (2)
ENVOhospital (76), farm (15), large river delta biome (3), waste treatment plant (2)
UBERONfeces (34), animal hemisphere (25), blood (19), intestine (5), renal system (4), alimentary part of gastrointestinal system (4), digestive tract (3), membrane organ (3), zone of skin (3), adult organism (2)
Classification16 ontology terms | Show
Parent Term(s)2 ontology terms | Show
Resistomes with Perfect MatchesEnterococcus faecalisp+wgs, Enterococcus faeciump+wgs, Klebsiella pneumoniaewgs, Staphylococcus aureusp+wgs, Streptococcus gallolyticuswgs
Resistomes with Sequence VariantsBrevibacillus laterosporuswgs, Enterococcus aviump, Enterococcus faecalisp+wgs, Enterococcus faeciumg+p+wgs, Klebsiella pneumoniaewgs, Staphylococcus aureusg+p+wgs, Streptococcus gallolyticuswgs
Publications

Marshall CG, et al. 1997. Proc Natl Acad Sci U S A 94(12): 6480-6483. D-Ala-D-Ala ligases from glycopeptide antibiotic-producing organisms are highly homologous to the enterococcal vancomycin-resistance ligases VanA and VanB. (PMID 9177243)

Resistomes

Prevalence of vanA among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 414 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GIGRDI-AMR2
Brevibacillus laterosporus0%0%11.76%0%0%
Enterococcus avium0%33.33%0%0%0%
Enterococcus faecalis0%2.71%8%0%0%
Enterococcus faecium0.96%10.75%48.59%0%0%
Klebsiella pneumoniae0%0%0.01%0%0%
Staphylococcus aureus0.7%0.19%0.1%0%0%
Streptococcus gallolyticus0%0%2.27%0%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 350


>gb|AAA65956.1|+|vanA [Enterococcus faecium]
MNRIKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPCAEWENDNCYSAVLSPDKKMHGLLVKKNHEYEINH
VDVAFSALHGKSGEDGSIQGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDRPVAATFTYPVFVKPARSGSSFG
VKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVVGEVDQIRLQYGIFRIHQEVEPEKGSENAVITVPADLSAEERG
RIQETAKKIYKALGCRGLARVDMFLQDNGRIVLNEVNTLPGFTSYSRYPRMMAAAGIALPELIDRLIVLALKG


>gb|M97297.1|+|6979-8010|vanA [Enterococcus faecium]
ATGAATAGAATAAAAGTTGCAATACTGTTTGGGGGTTGCTCAGAGGAGCATGACGTATCGGTAAAATCTGCAATAGAGATAGCCGCTAAC
ATTAATAAAGAAAAATACGAGCCGTTATACATTGGAATTACGAAATCTGGTGTATGGAAAATGTGCGAAAAACCTTGCGCGGAATGGGAA
AACGACAATTGCTATTCAGCTGTACTCTCGCCGGATAAAAAAATGCACGGATTACTTGTTAAAAAGAACCATGAATATGAAATCAACCAT
GTTGATGTAGCATTTTCAGCTTTGCATGGCAAGTCAGGTGAAGATGGATCCATACAAGGTCTGTTTGAATTGTCCGGTATCCCTTTTGTA
GGCTGCGATATTCAAAGCTCAGCAATTTGTATGGACAAATCGTTGACATACATCGTTGCGAAAAATGCTGGGATAGCTACTCCCGCCTTT
TGGGTTATTAATAAAGATGATAGGCCGGTGGCAGCTACGTTTACCTATCCTGTTTTTGTTAAGCCGGCGCGTTCAGGCTCATCCTTCGGT
GTGAAAAAAGTCAATAGCGCGGACGAATTGGACTACGCAATTGAATCGGCAAGACAATATGACAGCAAAATCTTAATTGAGCAGGCTGTT
TCGGGCTGTGAGGTCGGTTGTGCGGTATTGGGAAACAGTGCCGCGTTAGTTGTTGGCGAGGTGGACCAAATCAGGCTGCAGTACGGAATC
TTTCGTATTCATCAGGAAGTCGAGCCGGAAAAAGGCTCTGAAAACGCAGTTATAACCGTTCCCGCAGACCTTTCAGCAGAGGAGCGAGGA
CGGATACAGGAAACGGCAAAAAAAATATATAAAGCGCTCGGCTGTAGAGGTCTAGCCCGTGTGGATATGTTTTTACAAGATAACGGCCGC
ATTGTACTGAACGAAGTCAATACTCTGCCCGGTTTCACGTCATACAGTCGTTATCCCCGTATGATGGCCGCTGCAGGTATTGCACTTCCC
GAACTGATTGACCGCTTGATCGTATTAGCGTTAAAGGGGTGA

Curator Acknowledgements
Curator Description Most Recent Edit