ANT(2'')-Ia

Accession ARO:3000230
Synonym(s)aadB
CARD Short NameANT(2'')-Ia
DefinitionPlasmid or integron-encoded nucleotidylylation of 2-deoxystreptamine aminoglycosides at the hydroxyl group at position 2'' in P. aeruginosa, K. pneumoniae, Morganella morganii, E. coli, S. typhimurium, C. freundii and A. baumannii.
AMR Gene FamilyANT(2'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAchromobacter xylosoxidansp+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter indicuswgs, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiiwgs, Acinetobacter townerig, Aeromonas caviaeg+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p, Alcaligenes faecalisg+wgs, Burkholderia cepaciawgs, Burkholderia multivoranswgs, Burkholderia vietnamiensiswgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaep+wgs, Morganella morganiig+wgs, Pasteurella multocidag, Proteus mirabilisg+wgs, Proteus vulgarisp, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas monteiliiwgs, Pseudomonas putidap+wgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Sphingobium yanoikuyaep, Stenotrophomonas maltophiliag+wgs, Trueperella pyogenesg+wgs, Vibrio alginolyticusg+wgs, Vibrio parahaemolyticuswgs
Resistomes with Sequence VariantsAchromobacter xylosoxidansp+wgs, Acinetobacter baumanniig+p+wgs, Acinetobacter indicuswgs, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Acinetobacter pittiip+wgs, Acinetobacter townerig+wgs, Acinetobacter wuhouensisp, Aeromonas caviaeg+wgs, Aeromonas hydrophilap+wgs, Aeromonas veroniig+p, Alcaligenes faecalisg+wgs, Burkholderia cepaciawgs, Burkholderia multivoranswgs, Burkholderia vietnamiensiswgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Citrobacter werkmaniiwgs, Citrobacter youngaewgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeip+wgs, Enterobacter roggenkampiip+wgs, Enterococcus faecaliswgs, Enterococcus faeciumwgs, Escherichia albertiiwgs, Escherichia colig+p+wgs, Klebsiella aerogeneswgs, Klebsiella michiganensisp+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Klebsiella quasipneumoniaeg+p+wgs, Morganella morganiig+wgs, Neisseria brasiliensisg, Pasteurella multocidag, Proteus mirabilisg+wgs, Proteus vulgarisp+wgs, Providencia heimbachaep, Providencia rettgerip+wgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas mendocinawgs, Pseudomonas monteiliiwgs, Pseudomonas putidap+wgs, Pseudomonas stutzeriwgs, Salmonella entericag+p+wgs, Serratia marcescensp+wgs, Sphingobium yanoikuyaep, Stenotrophomonas maltophiliag+wgs, Trueperella pyogenesg+wgs, Vibrio alginolyticusg+wgs, Vibrio parahaemolyticuswgs
Classification10 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
+ ANT(2'') [AMR Gene Family]
Publications

Cameron FH, et al. 1986. Nucleic Acids Res 14(21): 8625-8635. Nucleotide sequence of the AAD(2'') aminoglycoside adenylyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aadA in R538-1 and dhfrII in R388. (PMID 3024112)

Cox G, et al. 2015. MBio 6(1): Structural and molecular basis for resistance to aminoglycoside antibiotics by the adenylyltransferase ANT(2″)-Ia. (PMID 25564464)

Resistomes

Prevalence of ANT(2'')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Achromobacter xylosoxidans0%14.29%1.63%0%
Acinetobacter baumannii3.2%1.81%8.92%0%
Acinetobacter indicus0%0%4.17%0%
Acinetobacter junii0%0%1.79%0%
Acinetobacter nosocomialis0%0%2.6%0%
Acinetobacter pittii0%1.05%3.62%0%
Acinetobacter towneri12.5%0%5.26%0%
Acinetobacter wuhouensis0%4.55%0%0%
Aeromonas caviae3.23%0%0.69%0%
Aeromonas hydrophila0%2.22%2%0%
Aeromonas veronii3.23%2.33%0%0%
Alcaligenes faecalis6.25%0%19.23%0%
Burkholderia cepacia0%0%6.76%0%
Burkholderia multivorans0%0%0.32%0%
Burkholderia vietnamiensis0%0%1.72%0%
Citrobacter freundii2.68%1.6%6.19%0%
Citrobacter koseri0%0%1.04%0%
Citrobacter werkmanii0%0%10.26%0%
Citrobacter youngae0%0%6.25%0%
Enterobacter asburiae0%0%5.33%0%
Enterobacter cloacae0%6.25%5.04%0%
Enterobacter hormaechei0.43%2.31%5.76%0%
Enterobacter kobei0%1.23%6.7%0%
Enterobacter roggenkampii0%1.09%3.64%0%
Enterococcus faecalis0%0%0.05%0%
Enterococcus faecium0%0%0.04%0%
Escherichia albertii0%0%1.08%0%
Escherichia coli0.13%0.08%0.67%0%
Klebsiella aerogenes0%0%0.62%0%
Klebsiella michiganensis0%0.74%1.49%0%
Klebsiella oxytoca0%4.1%1.96%0%
Klebsiella pneumoniae0.66%0.5%1.69%0%
Klebsiella quasipneumoniae0.96%1.89%3.29%0%
Morganella morganii10%0%4.14%0%
Neisseria brasiliensis100%0%0%0%
Pasteurella multocida5%0%0%0%
Proteus mirabilis2.2%0%4.52%0%
Proteus vulgaris0%12.5%6.67%0%
Providencia heimbachae0%100%0%0%
Providencia rettgeri0%5.56%11.03%0%
Providencia stuartii0%0%6.82%0%
Pseudomonas aeruginosa3.19%2.88%3.88%0%
Pseudomonas mendocina0%0%7.69%0%
Pseudomonas monteilii0%0%5%0%
Pseudomonas putida0%9.52%2.74%0%
Pseudomonas stutzeri0%0%6.73%0%
Salmonella enterica0.15%0.75%0.56%0%
Serratia marcescens0%0.66%5.38%0%
Sphingobium yanoikuyae0%7.69%0%0%
Stenotrophomonas maltophilia1.37%0%1.38%0%
Trueperella pyogenes9.09%0%10%0%
Vibrio alginolyticus1.37%0%2%0%
Vibrio parahaemolyticus0%0%0.31%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 300


>gb|AAC64365.1|+|ANT(2'')-Ia [Pseudomonas aeruginosa]
MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPA
WWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA


>gb|AF078527.1|+|3770-4303|ANT(2'')-Ia [Pseudomonas aeruginosa]
ATGGACACAACGCAGGTCACATTGATACACAAAATTCTAGCTGCGGCAGATGAGCGAAATCTGCCGCTCTGGATCGGTGGGGGCTGGGCG
ATCGATGCACGGCTAGGGCGTGTAACACGCAAGCACGATGATATTGATCTGACGTTTCCCGGCGAGAGGCGCGGCGAGCTCGAGGCAATA
GTTGAAATGCTCGGCGGGCGCGTCATGGAGGAGTTGGACTATGGATTCTTAGCGGAGATCGGGGATGAGTTACTTGACTGCGAACCTGCT
TGGTGGGCAGACGAAGCGTATGAAATCGCGGAGGCTCCGCAGGGCTCGTGCCCAGAGGCGGCTGAGGGCGTCATCGCCGGGCGGCCAGTC
CGTTGTAACAGCTGGGAGGCGATCATCTGGGATTACTTTTACTATGCCGATGAAGTACCACCAGTGGACTGGCCTACAAAGCACATAGAG
TCCTACAGGCTCGCATGCACCTCACTCGGGGCGGAAAAGGTTGAGGTCTTGCGTGCCGCTTTCAGGTCGCGATATGCGGCCTAA