ANT(2'')-Ia

Accession ARO:3000230
Synonym(s)aadB
DefinitionPlasmid or integron-encoded nucleotidylylation of 2-deoxystreptamine aminoglycosides at the hydroxyl group at position 2'' in P. aeruginosa, K. pneumoniae, Morganella morganii, E. coli, S. typhimurium, C. freundii and A. baumannii
AMR Gene FamilyANT(2'')
Drug Classaminoglycoside antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesAchromobacter xylosoxidansp, Acinetobacter baumanniig+p+wgs, Acinetobacter juniiwgs, Burkholderia cepaciawgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Escherichia colig+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap, Pseudomonas stutzeriwgs, Salmonella entericap+wgs, Serratia marcescenswgs
Resistomes with Sequence VariantsAchromobacter xylosoxidansp, Acinetobacter baumanniig+p+wgs, Acinetobacter juniiwgs, Acinetobacter nosocomialiswgs, Burkholderia cepaciawgs, Citrobacter freundiig+p+wgs, Citrobacter koseriwgs, Enterobacter asburiaewgs, Enterobacter cloacaep+wgs, Enterobacter hormaecheig+p+wgs, Enterobacter kobeiwgs, Enterococcus faeciumwgs, Escherichia colig+p+wgs, Klebsiella oxytocap+wgs, Klebsiella pneumoniaeg+p+wgs, Morganella morganiiwgs, Proteus mirabilisg+wgs, Proteus vulgariswgs, Providencia rettgeriwgs, Providencia stuartiiwgs, Pseudomonas aeruginosag+p+wgs, Pseudomonas putidap, Pseudomonas stutzeriwgs, Salmonella entericap+wgs, Serratia marcescenswgs, Stenotrophomonas maltophiliawgs
Classification10 ontology terms | Show
Parent Term(s)6 ontology terms | Show
+ confers_resistance_to_antibiotic gentamicin C [Antibiotic]
+ confers_resistance_to_antibiotic kanamycin A [Antibiotic]
+ confers_resistance_to_antibiotic tobramycin [Antibiotic]
+ confers_resistance_to_antibiotic gentamicin B [Antibiotic]
+ confers_resistance_to_antibiotic plazomicin [Antibiotic]
+ ANT(2'') [AMR Gene Family]
Publications

Cameron FH, et al. 1986. Nucleic Acids Res 14(21): 8625-8635. Nucleotide sequence of the AAD(2'') aminoglycoside adenylyltransferase determinant aadB. Evolutionary relationship of this region with those surrounding aadA in R538-1 and dhfrII in R388. (PMID 3024112)

Cox G, et al. 2015. MBio 6(1): Structural and molecular basis for resistance to aminoglycoside antibiotics by the adenylyltransferase ANT(2″)-Ia. (PMID 25564464)

Resistomes

Prevalence of ANT(2'')-Ia among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI for 88 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGS
Achromobacter xylosoxidans0%16.67%0%
Acinetobacter baumannii3.8%5.66%11.28%
Acinetobacter junii0%0%1.89%
Acinetobacter nosocomialis0%0%3.3%
Burkholderia cepacia0%0%11.9%
Citrobacter freundii5.26%5.66%5.73%
Citrobacter koseri0%0%3.45%
Enterobacter asburiae0%0%2.38%
Enterobacter cloacae0%6.9%8.98%
Enterobacter hormaechei1.61%1.65%5.75%
Enterobacter kobei0%0%7.25%
Enterococcus faecium0%0%0.06%
Escherichia coli0.22%0.12%0.66%
Klebsiella oxytoca0%11.67%1.95%
Klebsiella pneumoniae1.6%0.46%2.18%
Morganella morganii0%0%7.14%
Proteus mirabilis4.76%0%6.15%
Proteus vulgaris0%0%10%
Providencia rettgeri0%0%15.62%
Providencia stuartii0%0%8.33%
Pseudomonas aeruginosa3.07%5.77%4.82%
Pseudomonas fluorescens0%0%0%
Pseudomonas putida0%10%0%
Pseudomonas stutzeri0%0%6.94%
Ralstonia mannitolilytica0%0%0%
Ralstonia pickettii0%0%0%
Salmonella enterica0%0.45%0.54%
Serratia marcescens0%0%5.65%
Stenotrophomonas maltophilia0%0%1.85%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: The protein homolog model is an AMR detection model. Protein homolog models detect a protein sequence based on its similarity to a curated reference sequence. A protein homolog model has only one parameter: a curated BLASTP bitscore cutoff for determining the strength of a match. Protein homolog model matches to reference sequences are categorized on three criteria: perfect, strict and loose. A perfect match is 100% identical to the reference sequence along its entire length; a strict match is not identical but the bitscore of the matched sequence is greater than the curated BLASTP bitscore cutoff. Loose matches are other sequences with a match bitscore less than the curated BLASTP bitscore.

Bit-score Cut-off (blastP): 300


>gb|AAC64365.1|+|ANT(2'')-Ia [Pseudomonas aeruginosa]
MDTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPA
WWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA


>gb|AF078527|+|3770-4303|ANT(2'')-Ia [Pseudomonas aeruginosa]
ATGGACACAACGCAGGTCACATTGATACACAAAATTCTAGCTGCGGCAGATGAGCGAAATCTGCCGCTCTGGATCGGTGGGGGCTGGGCG
ATCGATGCACGGCTAGGGCGTGTAACACGCAAGCACGATGATATTGATCTGACGTTTCCCGGCGAGAGGCGCGGCGAGCTCGAGGCAATA
GTTGAAATGCTCGGCGGGCGCGTCATGGAGGAGTTGGACTATGGATTCTTAGCGGAGATCGGGGATGAGTTACTTGACTGCGAACCTGCT
TGGTGGGCAGACGAAGCGTATGAAATCGCGGAGGCTCCGCAGGGCTCGTGCCCAGAGGCGGCTGAGGGCGTCATCGCCGGGCGGCCAGTC
CGTTGTAACAGCTGGGAGGCGATCATCTGGGATTACTTTTACTATGCCGATGAAGTACCACCAGTGGACTGGCCTACAAAGCACATAGAG
TCCTACAGGCTCGCATGCACCTCACTCGGGGCGGAAAAGGTTGAGGTCTTGCGTGCCGCTTTCAGGTCGCGATATGCGGCCTAA