EreB

Accession ARO:3000363
Synonym(s)Ere(B)
CARD Short NameEreB
DefinitionEreB is an erythromycin esterase-like protein that hydrolyses the drug's lactone ring.
AMR Gene Familymacrolide esterase
Drug Classmacrolide antibiotic
Resistance Mechanismantibiotic inactivation
Resistomes with Perfect MatchesEnterobacter hormaecheiwgs, Enterobacter kobeiwgs, Klebsiella pneumoniaep+wgs, Morganella morganiig+wgs
Resistomes with Sequence VariantsEnterobacter hormaecheiwgs, Enterobacter kobeiwgs, Escherichia coliwgs, Klebsiella pneumoniaep+wgs, Morganella morganiig+wgs
Classification10 ontology terms | Show
Parent Term(s)5 ontology terms | Show
+ confers_resistance_to_antibiotic erythromycin [Antibiotic]
+ confers_resistance_to_antibiotic roxithromycin [Antibiotic]
+ confers_resistance_to_antibiotic clarithromycin [Antibiotic]
+ confers_resistance_to_antibiotic azithromycin [Antibiotic]
+ macrolide esterase [AMR Gene Family]
Publications

Nakamura A, et al. 2000. J. Antibiot. 53(5):516-24 Macrolide esterase-producing Escherichia coli clinically isolated in Japan. (PMID 10908116)

Resistomes

Prevalence of EreB among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Enterobacter hormaechei0%0%0.05%0%
Enterobacter kobei0%0%1.55%0%
Escherichia coli0%0%0.01%0%
Klebsiella pneumoniae0%0.03%0.13%0%
Morganella morganii4%0%3.45%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 700


>gb|CAA27626.1|+|EreB [Escherichia coli]
MRFEEWVKDKHIPFKLNHPDDNYDDFKPLRKIIGDTRVVALGENSHFIKEFFLLRHTLLRFFIEDLGFTTFAFEFGFAEGQIINNWIHGQ
GTDDEIGRFLKHFYYPEELKTTFLWLREYNKAAKEKITFLGIDIPRNGGSYLPNMEIVHDFFRTADKEALHIIDDAFNIAKKIDYFSTSQ
AALNLHELTDSEKCRLTSQLARVKVRLEAMAPIHIEKYGIDKYETILHYANGMIYLDYNIQAMSGFISGGGMQGDMGAKDKYMADSVLWH
LKNPQSEQKVIVVAHNAHIQKTPILYDGFLSCLPMGQRLKNAIGDDYMSLGITSYSGHTAALYPEVDTKYGFRVDNFQLQEPNEGSVEKA
ISGCGVTNSFVFFRNIPEDLQSIPNMIRFDSIYMKAELEKAFDGIFQIEKSSVSEVVYE


>gb|X03988.1|+|383-1642|EreB [Escherichia coli]
ATGAGGTTCGAAGAATGGGTCAAAGATAAGCATATTCCTTTCAAACTGAATCACCCTGATGATAATTACGATGATTTTAAGCCATTAAGA
AAAATAATTGGAGATACCCGAGTTGTAGCATTAGGTGAAAATTCTCATTTCATAAAAGAATTCTTTTTGTTACGACATACGCTTTTGCGT
TTTTTTATCGAAGATCTAGGTTTTACTACGTTTGCTTTTGAATTTGGTTTTGCTGAGGGTCAAATCATCAATAACTGGATACATGGACAA
GGAACTGACGATGAAATAGGCAGATTCTTAAAACACTTCTATTATCCAGAAGAGCTCAAAACCACATTTCTATGGCTAAGGGAGTACAAT
AAAGCAGCAAAAGAAAAAATCACATTTCTTGGCATTGATATACCCAGAAATGGAGGTTCATACTTACCAAATATGGAGATAGTGCATGAC
TTTTTTAGAACAGCGGATAAAGAAGCACTACACATTATCGATGATGCATTTAATATTGCAAAAAAGATTGATTACTTCTCCACATCACAG
GCAGCCTTAAATTTACATGAGCTAACAGATTCTGAGAAATGCCGTTTAACTAGCCAATTAGCTCGAGTAAAAGTTCGCCTTGAAGCTATG
GCTCCAATTCACATTGAAAAATATGGGATTGATAAATATGAGACAATTCTGCATTATGCCAACGGTATGATATACTTGGACTATAACATT
CAAGCTATGTCGGGCTTTATTTCAGGAGGCGGAATGCAGGGCGATATGGGTGCAAAAGACAAATACATGGCAGATTCTGTGCTGTGGCAT
TTAAAAAACCCACAAAGTGAGCAGAAAGTGATAGTAGTAGCACATAATGCACATATTCAAAAAACACCCATTCTGTATGATGGATTTCTA
AGTTGCCTACCAATGGGCCAAAGACTTAAAAATGCCATTGGTGATGATTATATGTCTTTAGGTATTACTTCTTATAGTGGGCATACTGCA
GCCCTCTATCCGGAAGTTGATACAAAATATGGTTTTCGAGTTGATAACTTCCAACTGCAGGAACCAAATGAAGGTTCTGTCGAGAAAGCT
ATTTCTGGTTGTGGAGTTACTAATTCTTTTGTCTTTTTTAGAAATATTCCTGAAGATTTACAATCCATCCCGAACATGATTCGATTTGAT
TCTATTTACATGAAAGCAGAACTCGAGAAAGCTTTCGATGGAATATTTCAAATTGAAAAGTCATCTGTATCTGAGGTCGTTTATGAATAA