abeM

Accession ARO:3000753
CARD Short NameabeM
DefinitionAbeM is an multidrug efflux pump found in Acinetobacter baumannii.
AMR Gene Familymultidrug and toxic compound extrusion (MATE) transporter
Drug Classfluoroquinolone antibiotic, disinfecting agents and antiseptics
Resistance Mechanismantibiotic efflux
Efflux Componentefflux pump complex or subunit conferring antibiotic resistance
Resistomes with Perfect MatchesAcinetobacter baumanniig+wgs
Resistomes with Sequence VariantsAcinetobacter baumanniig+wgs, Acinetobacter calcoaceticusg+wgs, Acinetobacter nosocomialisg+wgs, Acinetobacter pittiig+wgs, Klebsiella pneumoniaewgs, Pseudomonas aeruginosawgs, Vibrio alginolyticuswgs
Classification8 ontology terms | Show
Parent Term(s)7 ontology terms | Show
+ confers_resistance_to_drug_class fluoroquinolone antibiotic [Drug Class]
+ confers_resistance_to_antibiotic ciprofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic acriflavine [Antibiotic]
+ multidrug and toxic compound extrusion (MATE) transporter [AMR Gene Family]
+ confers_resistance_to_antibiotic norfloxacin [Antibiotic]
+ confers_resistance_to_antibiotic ofloxacin [Antibiotic]
+ confers_resistance_to_antibiotic triclosan [Antibiotic]
Publications

Su XZ, et al. 2005. Antimicrob Agents Chemother 49(10): 4362-4364. AbeM, an H+-coupled Acinetobacter baumannii multidrug efflux pump belonging to the MATE family of transporters. (PMID 16189122)

Resistomes

Prevalence of abeM among the sequenced genomes, plasmids, and whole-genome shotgun assemblies available at NCBI or IslandViewer for 377 important pathogens (see methodological details and complete list of analyzed pathogens). Values reflect percentage of genomes, plasmids, genome islands, or whole-genome shotgun assemblies that have at least one hit to the AMR detection model. Default view includes percentages calculated based on Perfect plus Strict RGI hits. Select the checkbox to view percentages based on only Perfect matches to AMR reference sequences curated in CARD (note: this excludes resistance via mutation as references in protein variant models are often wild-type, sensitive sequences).

Prevalence: protein homolog model (view sequences)

SpeciesNCBI ChromosomeNCBI PlasmidNCBI WGSNCBI GI
Acinetobacter baumannii99.32%0%71.02%0%
Acinetobacter calcoaceticus20%0%8.7%0%
Acinetobacter nosocomialis100%0%76.62%0%
Acinetobacter pittii96.88%0%81.91%0%
Escherichia coli0%0%0%0%
Klebsiella pneumoniae0%0%0.04%0%
Pseudomonas aeruginosa0%0%0.03%0%
Vibrio alginolyticus0%0%0.67%0%
Show Perfect Only


Detection Models

Model Type: protein homolog model

Model Definition: Protein Homolog Models (PHM) detect protein sequences based on their similarity to a curated reference sequence, using curated BLASTP bitscore cut-offs. Protein Homolog Models apply to all genes that confer resistance through their presence in an organism, such as the presence of a beta-lactamase gene on a plasmid. PHMs include a reference sequence and a bitscore cut-off for detection using BLASTP. A Perfect RGI match is 100% identical to the reference protein sequence along its entire length, a Strict RGI match is not identical but the bit-score of the matched sequence is greater than the curated BLASTP bit-score cutoff, Loose RGI matches have a bit-score less than the curated BLASTP bit-score cut-off.

Bit-score Cut-off (blastP): 850


>gb|BAD89844.2|+|abeM [Acinetobacter baumannii]
MSNVTSFRSELKQLFHLMLPILITQFAQAGFGLIDTIMAGHLSAADLAAIAVGVGLWIPVMLLFSGIMIATTPLVAEAKGARNTEQIPVI
VRQSLWVAVILGVLAMLILQLMPFFLHVFGVPESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPRPVTVISLLALVVLIPLNMIF
MYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKASAYRNTSIFSRFDKISLTWVKRILQLGLPIGLAVFFEVSIFSTGALVLSPLGE
VFIAAHQVAISVTSVLFMIPLSLAIALTIRVGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSFIALGREQIVSVYTQDINVVPVAMYLL
WFAMAYQLMDALQVSAAGCLRGMQDTQAPMWITLMAYWVIAFPIGLYLARYTDWGVAGVWLGLIIGLSIACVLLLSRLYLNTKRLSQT


>gb|AB204810.2|+|187-1533|abeM [Acinetobacter baumannii]
GTGTCGAATGTCACGTCGTTTCGGTCTGAATTAAAACAACTCTTCCATTTAATGTTACCTATTTTAATTACGCAGTTTGCTCAAGCAGGG
TTCGGGTTAATTGATACCATTATGGCTGGGCATTTATCTGCCGCAGACTTAGCCGCTATTGCGGTAGGTGTAGGCTTATGGATTCCAGTC
ATGCTCTTGTTCAGTGGCATCATGATTGCAACCACACCATTAGTTGCCGAAGCAAAAGGCGCTAGAAATACAGAGCAAATTCCAGTGATT
GTCCGCCAATCATTATGGGTTGCAGTAATTCTAGGGGTATTGGCAATGCTCATTTTGCAGCTTATGCCATTTTTCTTACATGTGTTTGGC
GTACCAGAAAGTTTACAACCTAAAGCCAGTTTATTCTTACATGCAATTGGTTTGGGTATGCCCGCTGTAACCATGTATGCAGCGCTCCGA
GGCTATTCCGAAGCATTAGGCCATCCCCGCCCTGTCACGGTCATTAGCTTACTAGCCTTAGTGGTTTTAATCCCGCTTAACATGATTTTT
ATGTATGGCTTAGGACCAATACCTGCTTTGGGTAGCGCAGGCTGTGGTTTTGCAACATCCATTTTACAGTGGCTGATGCTCATTACGTTA
GCAGGCTATATTTATAAGGCTTCGGCTTATCGAAACACATCTATTTTTAGCAGATTCGATAAAATTAGCCTGACTTGGGTTAAAAGAATT
TTACAGCTCGGCCTGCCAATTGGTTTAGCTGTGTTTTTTGAAGTGAGTATTTTTAGTACAGGGGCATTGGTCCTTAGCCCTCTAGGGGAA
GTCTTTATTGCCGCACACCAAGTAGCAATTTCAGTCACTTCGGTACTGTTTATGATTCCACTTTCTCTTGCCATTGCTTTAACCATTCGC
GTGGGGACGTATTATGGTGAAAAGAACTGGGCTTCCATGTACCAAGTACAGAAAATTGGTCTAAGCACAGCAGTATTTTTTGCTCTATTG
ACCATGTCTTTTATTGCTTTAGGCCGTGAACAAATTGTCTCGGTTTATACTCAAGATATAAATGTTGTGCCGGTTGCCATGTATTTGCTC
TGGTTTGCAATGGCATATCAATTAATGGATGCTCTACAAGTCAGCGCTGCCGGCTGTTTAAGAGGTATGCAAGATACTCAGGCACCGATG
TGGATCACCTTAATGGCGTATTGGGTAATTGCTTTTCCAATCGGTCTTTATTTAGCGCGTTATACCGATTGGGGCGTAGCTGGTGTGTGG
TTAGGTTTAATTATTGGTTTAAGTATTGCCTGTGTTTTATTGCTATCACGACTCTATTTGAATACCAAACGTTTAAGTCAAACCTAA